SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 216389.DehaBAV1_0812 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  216389.DehaBAV1_0812
Domain Number 1 Region: 37-112
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 5.86e-19
Family Ferredoxin domains from multidomain proteins 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 216389.DehaBAV1_0812
Sequence length 183
Comment (Dehalococcoides BAV1)
Sequence
MSVLSNTGGGILKGMRLTFKHLFRPWITVQYPEEKLAMSKRIRGNQVIWVKETCIACLAC
ARACPVKAINMEVSRGEDRKLKVDHMSIDFGLCIFCGLCVESCPTKNAIYMGCGYETTTY
RCTNVEKAEGQSFSECRCRELILTGDELGPSETRVLSGYDRPDAAEKLPLQTLLINKKGY
FER
Download sequence
Identical sequences A0A142VB96
gi|452203682|ref|YP_007483815.1| gi|452205125|ref|YP_007485254.1| gi|147669455|ref|YP_001214273.1| 216389.DehaBAV1_0812 WP_011929113.1.17753 WP_011929113.1.45256 WP_011929113.1.48192 WP_011929113.1.52557 WP_011929113.1.55841 WP_011929113.1.5855 WP_011929113.1.62194 WP_011929113.1.66924 WP_011929113.1.67918 WP_011929113.1.74482 WP_011929113.1.75083 WP_011929113.1.79047 WP_011929113.1.83924 WP_011929113.1.84634 WP_011929113.1.89941 WP_011929113.1.91135 WP_011929113.1.92458 gi|289432722|ref|YP_003462595.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]