SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 216389.DehaBAV1_1144 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  216389.DehaBAV1_1144
Domain Number 1 Region: 60-125
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000000602
Family NfeD domain-like 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 216389.DehaBAV1_1144
Sequence length 126
Comment (Dehalococcoides BAV1)
Sequence
MNIRLVWTVFTTLLEGVGIAFLGLWLLPQIDFQLPLWVILLAEAVLLVSSVYFYHVGTVT
LDQKPHTGSETIIGSSAVVVESVNPKGMIRLDGELWEAVTSGVPIPRGGEVVVVGRDKMR
LWVKPK
Download sequence
Identical sequences WP_012034104.1.45256 gi|147669783|ref|YP_001214601.1| 216389.DehaBAV1_1144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]