SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 216591.BCAL1043 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  216591.BCAL1043
Domain Number 1 Region: 144-419
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 7.66e-84
Family D-glucarate dehydratase-like 0.000000000753
Further Details:      
 
Domain Number 2 Region: 12-142
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.43e-33
Family Enolase N-terminal domain-like 0.00000158
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 216591.BCAL1043
Sequence length 450
Comment (Burkholderia cenocepacia J2315)
Sequence
MNAVTASPSPDTPRIVDLQAIPVAGHDSMLLNLSGAHGPFFTRNLVILKDSAGRTGVGEV
PGGESIRRTLDDARALVVGQPVGNYHAVLNDVRRTFADRDASGRGLQTFDLRTTIHAVTA
LEAALLDLLGQHLGVPVAALLGEGQQRERVEMLGYLFYVGDRTKTALPYRDGRGATDDWT
RVRDEAALTPEAVVRLAEAAHARYGFNDFKLKGGVFAGASEIEAVTALAERFPDARVTLD
PNGAWSLDEAVRLCRDQHHVLAYAEDPCGAENGYSGREVMAEFRRATGLPTATNMIATDW
RQMGHAVQLHAVDIPLADPHFWTMQGSVRVAQMCRDWGLTWGSHSNNHFDVSLAMFTHVA
AAAPGQVTAIDTHWIWQDGERLTREPLKIENGLVEVPKRPGLGIDIDMDAVALAHELYKQ
HGLGARDDAAAMQYLIPGWTFNNKRPCLVR
Download sequence
Identical sequences A0A125H2J2 B4ECK5
WP_006484312.1.10003 WP_006484312.1.100292 WP_006484312.1.100706 WP_006484312.1.101897 WP_006484312.1.10541 WP_006484312.1.10851 WP_006484312.1.11355 WP_006484312.1.11512 WP_006484312.1.1166 WP_006484312.1.12746 WP_006484312.1.13079 WP_006484312.1.1352 WP_006484312.1.13636 WP_006484312.1.14088 WP_006484312.1.15457 WP_006484312.1.15547 WP_006484312.1.16401 WP_006484312.1.16963 WP_006484312.1.18053 WP_006484312.1.19408 WP_006484312.1.19923 WP_006484312.1.19997 WP_006484312.1.21852 WP_006484312.1.22015 WP_006484312.1.22175 WP_006484312.1.22218 WP_006484312.1.24796 WP_006484312.1.25034 WP_006484312.1.25261 WP_006484312.1.25912 WP_006484312.1.27304 WP_006484312.1.27889 WP_006484312.1.27910 WP_006484312.1.28724 WP_006484312.1.29408 WP_006484312.1.30820 WP_006484312.1.31157 WP_006484312.1.31547 WP_006484312.1.32398 WP_006484312.1.33877 WP_006484312.1.34650 WP_006484312.1.34976 WP_006484312.1.35688 WP_006484312.1.36423 WP_006484312.1.38451 WP_006484312.1.38687 WP_006484312.1.39276 WP_006484312.1.40288 WP_006484312.1.42088 WP_006484312.1.43021 WP_006484312.1.43226 WP_006484312.1.43417 WP_006484312.1.44508 WP_006484312.1.45869 WP_006484312.1.46650 WP_006484312.1.46700 WP_006484312.1.46780 WP_006484312.1.46794 WP_006484312.1.46998 WP_006484312.1.48439 WP_006484312.1.48997 WP_006484312.1.49743 WP_006484312.1.4986 WP_006484312.1.50840 WP_006484312.1.51790 WP_006484312.1.51974 WP_006484312.1.52424 WP_006484312.1.52657 WP_006484312.1.52705 WP_006484312.1.55042 WP_006484312.1.55485 WP_006484312.1.55547 WP_006484312.1.56058 WP_006484312.1.57358 WP_006484312.1.57447 WP_006484312.1.57568 WP_006484312.1.5773 WP_006484312.1.59223 WP_006484312.1.59344 WP_006484312.1.59475 WP_006484312.1.60885 WP_006484312.1.6305 WP_006484312.1.63472 WP_006484312.1.6376 WP_006484312.1.64016 WP_006484312.1.64618 WP_006484312.1.66306 WP_006484312.1.67103 WP_006484312.1.67642 WP_006484312.1.68100 WP_006484312.1.68277 WP_006484312.1.69134 WP_006484312.1.69601 WP_006484312.1.70783 WP_006484312.1.71091 WP_006484312.1.71103 WP_006484312.1.71282 WP_006484312.1.71578 WP_006484312.1.71688 WP_006484312.1.72171 WP_006484312.1.7270 WP_006484312.1.73989 WP_006484312.1.75651 WP_006484312.1.75714 WP_006484312.1.75887 WP_006484312.1.77749 WP_006484312.1.77887 WP_006484312.1.78085 WP_006484312.1.78834 WP_006484312.1.79353 WP_006484312.1.79411 WP_006484312.1.79438 WP_006484312.1.80650 WP_006484312.1.80961 WP_006484312.1.81932 WP_006484312.1.82124 WP_006484312.1.82360 WP_006484312.1.82669 WP_006484312.1.83171 WP_006484312.1.83220 WP_006484312.1.83528 WP_006484312.1.83765 WP_006484312.1.85154 WP_006484312.1.85579 WP_006484312.1.85676 WP_006484312.1.85744 WP_006484312.1.86231 WP_006484312.1.8632 WP_006484312.1.86513 WP_006484312.1.87490 WP_006484312.1.87780 WP_006484312.1.87798 WP_006484312.1.88184 WP_006484312.1.88381 WP_006484312.1.8869 WP_006484312.1.88782 WP_006484312.1.88916 WP_006484312.1.89316 WP_006484312.1.8972 WP_006484312.1.89769 WP_006484312.1.89946 WP_006484312.1.90806 WP_006484312.1.90836 WP_006484312.1.90933 WP_006484312.1.91074 WP_006484312.1.92028 WP_006484312.1.92582 WP_006484312.1.92898 WP_006484312.1.92934 WP_006484312.1.95357 WP_006484312.1.95626 WP_006484312.1.95790 WP_006484312.1.97307 WP_006484312.1.98001 WP_006484312.1.98120 WP_006484312.1.98227 WP_006484312.1.98528 WP_006484312.1.99008 WP_006484312.1.99710 WP_006484312.1.99967 216591.BCAL1043 gi|206559430|ref|YP_002230191.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]