SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 216591.BCAM0805 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  216591.BCAM0805
Domain Number 1 Region: 119-374
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 5.11e-63
Family D-glucarate dehydratase-like 0.000000383
Further Details:      
 
Domain Number 2 Region: 7-132
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.33e-33
Family Enolase N-terminal domain-like 0.00000627
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 216591.BCAM0805
Sequence length 377
Comment (Burkholderia cenocepacia J2315)
Sequence
MIATAATIERIDTLLVDVPTIRPHKLSVATMNCQTLVLVRVRCTDGIEGVGEATTIGGLA
YGEESPESIKVNIDTYFAPLLQGMDATRPGAAIARARKLFQGNRFAKCAIETALFDAQAR
RLGVPLSELFGGRRTDAVDVAWTLASGDTQRDIAEAEAMLDARRHRAFKLKIGSNAVADD
VAHVVAIKRALGERGDVRVDVNQAWSETDAIWAGARLADAGVSLVEQPIAATNRAGLKRL
TQLARVPIMADEALHGPVDAFALAQDRAADVFAVKIAQSGGLQGAASVASIAAAAGIELY
GGTMLEGAAGTMASAQLFSTFDSLKWGTELFGPLLLTEEILVEPLRYQDFKLHLPATPGL
GITFDWARIERMRRDAR
Download sequence
Identical sequences A0A1V2WZG1 B4EMK7
WP_006484346.1.10003 WP_006484346.1.100706 WP_006484346.1.101897 WP_006484346.1.10541 WP_006484346.1.11355 WP_006484346.1.14088 WP_006484346.1.21852 WP_006484346.1.22015 WP_006484346.1.25261 WP_006484346.1.27304 WP_006484346.1.27889 WP_006484346.1.27910 WP_006484346.1.29408 WP_006484346.1.31157 WP_006484346.1.31547 WP_006484346.1.33877 WP_006484346.1.34650 WP_006484346.1.38687 WP_006484346.1.40288 WP_006484346.1.45869 WP_006484346.1.52424 WP_006484346.1.52705 WP_006484346.1.55547 WP_006484346.1.57568 WP_006484346.1.60885 WP_006484346.1.64618 WP_006484346.1.66306 WP_006484346.1.67103 WP_006484346.1.67642 WP_006484346.1.69134 WP_006484346.1.70783 WP_006484346.1.71578 WP_006484346.1.71688 WP_006484346.1.72171 WP_006484346.1.7270 WP_006484346.1.75651 WP_006484346.1.79353 WP_006484346.1.82360 WP_006484346.1.83528 WP_006484346.1.85579 WP_006484346.1.86231 WP_006484346.1.87780 WP_006484346.1.87798 WP_006484346.1.88782 WP_006484346.1.90806 WP_006484346.1.92582 WP_006484346.1.95357 WP_006484346.1.95626 WP_006484346.1.95790 WP_006484346.1.98001 WP_006484346.1.99008 216591.BCAM0805 gi|206562662|ref|YP_002233425.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]