SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 216594.MMAR_0864 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  216594.MMAR_0864
Domain Number 1 Region: 145-375
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 5.01e-48
Family D-glucarate dehydratase-like 0.000000321
Further Details:      
 
Domain Number 2 Region: 1-137
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.85e-16
Family Enolase N-terminal domain-like 0.0000941
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 216594.MMAR_0864
Sequence length 385
Comment (Mycobacterium marinum M)
Sequence
MRIVAILERPVRLLGGPANAVVNFSQHTVSLVAVVSDVIRHGKPLTGVAFNSIGRFAQSG
ILRDRMIPRVLAAPEDALLDQRGHLDPAAVLRHAVCDEKPGGHGDRAGAAAAVELACWDL
AAKLNDEPAYATIARHFGRDPAPLVSVYAAGGYYYPGGGLNALRDEMRRYLDLGYDAVKM
KIGGVAQRDDLARIEAVIDVVGADRVAVDANGRFDRAAATRWAATLAPYGLRWYEEPGDP
LDFELNRAVTGCYAGTVATGENLFSVPDVTNLVRYGGMRAGRDIFQMDAGLSYGLGEYVR
MLELIEAHGFDRRCAYPHGGHMINLHIAAGLGLGGCESYPGVFQPFGGYCDGCVLRDGQI
VPTDAPGFGLERKPGLGELISELTR
Download sequence
Identical sequences B2HRL0
WP_012392795.1.90902 216594.MMAR_0864 gi|183980886|ref|YP_001849177.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]