SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 216594.MMAR_0913 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  216594.MMAR_0913
Domain Number - Region: 436-509
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0102
Family Anti-sigma factor antagonist SpoIIaa 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 216594.MMAR_0913
Sequence length 533
Comment (Mycobacterium marinum M)
Sequence
MPHIEQLDKQGLDHAQHPGTPEPPTTSRLSRVSQISRPDRVRSVIRHDLPASLVVFLVAL
PLSLGIAIASDAPVLAGLIAAVVGGIIGGALGGSPLQVSGPAAGLTVVVADLIAEFGWGI
TCFITAVAGLMQILLGFSRVARAALAISPVVVHAMLAGIGITIALQQTHVLLGGESHSTA
WANVVELPAQIVGAHRPGVILGLLVIAIMVAWRWAPAKVAPVPGPLVAIVVVTVVSVVFP
FHVSRITLEGSVVDALQLPAIPHGNWGAIVIGIITVTLITSVQSLLTAVATDRMHSGPTT
ELNRELIGQGASNVVSGAIGGLPIAGVIVRSAANIKAGAKTRASTILHGFWVLLFALPFA
GLIEQIPSAALAGLLIVIGIQLLQPAHIETAVKTGDFAIYLVTIVAVVFLNLLHGVMIGL
ALAIAMTGWRVLRAKVEAHQIDGEWRVVVEGACTFLSLPRLTRVLASVPDSATVTLHIAV
NYLDHAAHQAITDWQRRHHATGGKVRIDGALRRGHFANDGTQLVHDEKSEAAA
Download sequence
Identical sequences B2HRQ8
gi|183980934|ref|YP_001849225.1| WP_012392835.1.48473 WP_012392835.1.90902 216594.MMAR_0913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]