SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 216594.MMAR_1266 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  216594.MMAR_1266
Domain Number 1 Region: 531-734
Classification Level Classification E-value
Superfamily beta-carbonic anhydrase, cab 6.15e-42
Family beta-carbonic anhydrase, cab 0.00048
Further Details:      
 
Weak hits

Sequence:  216594.MMAR_1266
Domain Number - Region: 436-503
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0491
Family Anti-sigma factor antagonist SpoIIaa 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 216594.MMAR_1266
Sequence length 748
Comment (Mycobacterium marinum M)
Sequence
MSTAVKNSAEAPESRSQWMRANLRHDFPASLVVFLVALPLSLGIAIASGAPLMAGLIAAV
VGGIVAGLLGGSSVQVSGPAAGLTVVVAGLIEQVGWQMLCLMTLGAGVLQIIFGLSRMAR
AALAIAPVVVHAMLAGIGVTIVLQQIHVLMGGSAHSSAWRNIAALPNGILHHELHEVIVG
GTVIAILLVWSRLPAMVRMVPGPLVAIAGATALSLMVNLDVERINLSGNFFEAISLPRLP
ELTPDGQPWSNDISIIAVGVLTIALIASVESLLCAVGVDKLHHGPRTNFNREMLGQGSAN
VLSGLLGGLPVTGVIVRSSANVAAGARTRTSAVLHGVWILLFASLFTGLVELIPKAALAG
LLIVVGAQLIQLAHIQIAWRTGNFAIYVITILGVIFLNLLEGVVIGLGVAIAFLLIRVIR
APIEARLVSEEAKRWRVDIDGTLSFLLLPRLTNVLSELPEGSDITLNLNADYIDHSVSEA
ISDWKTAHEATGGEVTIIETSPANLVSAHTSPPKRHFMSRALREPWTSRRDSHPDAEPSI
RHGVEEYHRNGIGTLHHHVRELMDPANPDTVFLTCADSRILPDVITASKPGDLYIVRNVG
NLVPIDPTERSVDAALDFAVNQLGVSSVVVCGHSSCRSMQALLDNGASDVDRPMNHWLEH
AHDSLAAFRDGHPARASAASVGFGELDQLAVVNVAVQLERLAHNQVLAPAIASGAIQIVG
MFFDFSTVHVHEVDQLGIVASNQPVGKP
Download sequence
Identical sequences A0A1B4Y0F6 B2HEL7
WP_012393139.1.90902 216594.MMAR_1266 gi|183981288|ref|YP_001849579.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]