SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 216594.MMAR_5181 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  216594.MMAR_5181
Domain Number 1 Region: 10-113
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.43e-19
Family Anti-sigma factor antagonist SpoIIaa 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 216594.MMAR_5181
Sequence length 122
Comment (Mycobacterium marinum M)
Sequence
MSAPDSITAVVTDHDGVTVLSIGGEIDLVTAPALEEAIGAVVADSPTALVIDLSGVEFLG
SVGLKILAATYEKLGTAAEFGVVAQGPATRRPIHLTGLDKTFPLYPALDDALTGVRDGKL
NR
Download sequence
Identical sequences B2HK89
gi|183985150|ref|YP_001853441.1| 216594.MMAR_5181 WP_012396695.1.90902 MymaA.17065.a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]