SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 216594.MMAR_5348 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  216594.MMAR_5348
Domain Number - Region: 23-61
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00144
Family NfeD domain-like 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 216594.MMAR_5348
Sequence length 76
Comment (Mycobacterium marinum M)
Sequence
MSDASVIGCVGTLVVATRGKHGAGEVLLTVRGSKEAFLARSDHPLPKGTTVLVVGVRGAR
TVLVEPWNDLVVTELL
Download sequence
Identical sequences B2HMI3
gi|183985316|ref|YP_001853607.1| 216594.MMAR_5348 WP_012396852.1.28311 WP_012396852.1.48473 WP_012396852.1.90902 WP_012396852.1.91103 WP_012396852.1.92715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]