SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 216595.PFLU1903 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  216595.PFLU1903
Domain Number 1 Region: 141-425
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.76e-116
Family Enolase 0.000000132
Further Details:      
 
Domain Number 2 Region: 5-137
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.3e-55
Family Enolase N-terminal domain-like 0.0000052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 216595.PFLU1903
Sequence length 427
Comment (Pseudomonas fluorescens SBW25)
Sequence
MKTQIQAIHAREILDSRGNPTVEVDVTLECGTLGRASVPSGASTGAHEAVELRDHDPKRY
SGRGVLKAVSNVNTEILESLRGQDAVDQEQIDHLMIKLDGTPDKSRLGGNAILGVSLAVA
RASASAMKVPLFQYLGGEQAARMPVPMFNILNGGVHANWQGPDFQEFMIAPTGAGSFKEA
LRWGAEVYHELKAVLKDAGYSTAVGDEGGFAPTLKKNSDAIELIIKAIERAGYTPGSQIE
IAIDPASSGFYENGLYHLRSEGRKVDAQELISLYSSWVDKYPIAVLEDGLAEDDWSGWKQ
LNAALGNRIELVGDDLFVTNVERIQRGIKENVANAVLIKPNQIGTLTETKAAIVMAYGAN
WGAMVSHRSGETVDSFIADLTVAMGTGHLKTGAPCRGERVEKYNQFLRIEEHLGSHAFYA
GHDAFVR
Download sequence
Identical sequences A0A0W0KJR7 A0A1H0DCW5 A0A1H9YES0 C3K510
WP_012723166.1.11674 WP_012723166.1.131 WP_012723166.1.23922 WP_012723166.1.25774 WP_012723166.1.49784 WP_012723166.1.52017 WP_012723166.1.58699 WP_012723166.1.72581 WP_012723166.1.9193 WP_012723166.1.92627 gi|229589418|ref|YP_002871537.1| 216595.PFLU1903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]