SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 216595.PFLU2450 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  216595.PFLU2450
Domain Number 1 Region: 32-94
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.000000000000104
Family Probable transcriptional regulator VC1968, N-terminal domain 0.097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 216595.PFLU2450
Sequence length 101
Comment (Pseudomonas fluorescens SBW25)
Sequence
MAKKFAELQARMTPQARAEAKQLFQQHLQQMPLHELRKAQQLSQQSLAKALNINQAAVSK
MERRTDMYISTLRDYIRAMGGELEIIATFPDGQVKIDNFAY
Download sequence
Identical sequences A0A177X5A6 A0A1I7LU59 C3K8M1
216595.PFLU2450 WP_012723667.1.23922 WP_012723667.1.48276 WP_012723667.1.50861 WP_012723667.1.596 WP_012723667.1.92916 gi|229589929|ref|YP_002872048.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]