SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 216595.PFLU5192 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  216595.PFLU5192
Domain Number 1 Region: 117-372
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 3.28e-65
Family D-glucarate dehydratase-like 0.0000000162
Further Details:      
 
Domain Number 2 Region: 6-130
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 6.48e-33
Family Enolase N-terminal domain-like 0.0000016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 216595.PFLU5192
Sequence length 375
Comment (Pseudomonas fluorescens SBW25)
Sequence
MPICPIESIDTIIVDLPTIRPHKLAMHTLQNQTLVVIRLRCSDGIEGIGEATTIGGLSYG
NESPDSIKVNIDRHFAPLLIGQNASNINAAMLRLERSIRGNTFAKSGIESALLDALGKRL
NLPVSELLGGRVREALPVAWTLASGNTEKDIAEAEKMLDLRRHRIFKLKIGAGEVSHDLA
HVLAIKKALGDRASVRVDVNQAWDEAVALRACKVLGDNGIDLIEQPISRNNRGGMARLNL
SSPAPIMADESIECVEDAFNLAREGAASVFALKIAKNGGPRAVLRTAAIAEAAGIGLYGG
TMLEGGIGTLASAHAFLTLNKLAWDTELFGPLLLTEDILTEPPVYRDFQLHVSNAPGLGL
AIDEERLAFFRRDKH
Download sequence
Identical sequences C3K1Z9
gi|229592576|ref|YP_002874695.1| 216595.PFLU5192 WP_015885863.1.23922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]