SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 216595.PFLU5869 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  216595.PFLU5869
Domain Number - Region: 89-147
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000968
Family NfeD domain-like 0.0087
Further Details:      
 
Domain Number - Region: 18-92
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0122
Family Glycerol-3-phosphate transporter 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 216595.PFLU5869
Sequence length 148
Comment (Pseudomonas fluorescens SBW25)
Sequence
MWDFLQHLSFWDWLALGTVLLILEVFGAGGYLLWMGIAAAAVGVIKFLVPPLGLEWQLLL
FAVLSILTAVYWWKRQRSSAKASDQPGLNERGSELIGRTFVVHQAIVDGRGKVKVGDGVW
MVTGPDSPVGAQVRVVGQEGVVLKVETV
Download sequence
Identical sequences A0A177X6H3 A0A1I7ID98 C3K3W0
gi|229593237|ref|YP_002875356.1| 216595.PFLU5869 WP_015886433.1.23922 WP_015886433.1.48276 WP_015886433.1.50861 WP_015886433.1.596 WP_015886433.1.92916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]