SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 216596.RL0224 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  216596.RL0224
Domain Number 1 Region: 161-284
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.89e-33
Family NlpC/P60 0.0019
Further Details:      
 
Weak hits

Sequence:  216596.RL0224
Domain Number - Region: 58-89
Classification Level Classification E-value
Superfamily SH3-domain 0.0835
Family SH3-domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 216596.RL0224
Sequence length 285
Comment (Rhizobium leguminosarum bv viciae 3841)
Sequence
MTMLDCRLHAYRSDLAEAGLEGKVEAPRFTEGTPARVAVPVVALRPEPDLARGIDTELLL
GEDVTVFDRADGWCWVKAASDGYVGYVKADALLEGRPAATHIVTVQRTFLYPEPELRKPH
QAILSMGSRIHVAGETEARGNRYVVLEDGTAIFAKHVQPIGALDGADYVEIVARFLETPY
LWGGRSGLGIDCSGLVQLAMLMTGRAAPRDTDMQAAGLGQPIDRSELRRGDLVFWKGHVA
VFEDPETILHANGHSMTVARENFAAAVERIGWLYEQPTGYRRPIS
Download sequence
Identical sequences Q1MMT9
gi|116249991|ref|YP_765829.1| WP_011650032.1.53928 216596.RL0224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]