SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 216596.RL0935 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  216596.RL0935
Domain Number 1 Region: 17-174
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.9e-36
Family GHMP Kinase, N-terminal domain 0.00011
Further Details:      
 
Domain Number 2 Region: 178-294
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.99e-26
Family 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 216596.RL0935
Sequence length 303
Comment (Rhizobium leguminosarum bv viciae 3841)
Sequence
MMSSENRSHFSASCSSITEEARAKINLALHVTGQRPDGYHLLDMLVTFADHGDRLDFVPS
PTDAFTLSGRFGGTLAGGSGTNLVLKARDLLRAAIGPLAFPVRIHLEKNLPIASGIGGGS
ADAAATLRGLTRLWGATLPEEALAALALKLGADVPMCLESRPLIARGIGEELEPVPELPA
FAMVLANPLKGVSTPEVFRRLAEKNNPALSLALSRPQTADWLAAIAAARNDLEPPARELV
PEIAAISAMLQAHGALLTRMSGSGATCFGIFATMAAAKDAAAALHEARLDWYFQATETVS
GGV
Download sequence
Identical sequences Q1MKS2
WP_011650676.1.100861 WP_011650676.1.53928 216596.RL0935 gi|116250709|ref|YP_766547.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]