SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 216596.RL3093 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  216596.RL3093
Domain Number 1 Region: 32-106
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000314
Family Anti-sigma factor antagonist SpoIIaa 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 216596.RL3093
Sequence length 112
Comment (Rhizobium leguminosarum bv viciae 3841)
Sequence
MEISDENFRVWAEKNEVYFDGVFRLAGPDAYAPIYSLISGLLHEGHKQVTFNLTGLEFLN
SSGINLLAKLTIEARKMDDLLLVVKGTSQYPWQAKSLPNLKKLHPLVDLRLA
Download sequence
Identical sequences J0BLD4 Q1MEP5
WP_003541035.1.3993 WP_003541035.1.53928 WP_003541035.1.70093 WP_003541035.1.81419 216596.RL3093 gi|116252836|ref|YP_768674.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]