SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 216596.RL3864 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  216596.RL3864
Domain Number 1 Region: 104-384
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.31e-74
Family D-glucarate dehydratase-like 0.0001
Further Details:      
 
Domain Number 2 Region: 1-121
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 3.38e-30
Family Enolase N-terminal domain-like 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 216596.RL3864
Sequence length 388
Comment (Rhizobium leguminosarum bv viciae 3841)
Sequence
MKITSVRPWLIRSDASYWGEFLFVEVTTDEGVSGWGEITTTTRLANRALCTILRQIGAAL
KGDDPARIEYLWHKIFRSFTYMGSRGAAVECVSAIDIALWDIRGKVLGKPIYELLGGPVR
DEIALYTHPNQAKFTSKEAVVREIRDIVESGHTALKFDPFPYQGRTADGQPREQRDGYLD
GSMTRKDEREAAELTALIRETAGPDVDILIDAHGRFDVPTAIRLCRSLEEAGQIDWFEEP
CPPESLNALRQVREKVSAPISWGERGHTKWDFVPVLENRLADYIMPDVTWTGGITELKKI
SALCEAYYIPVSPHDAAGPINVVAGAQVMMTVPNFYKLETSEWNLGKYDHLIDRPLDVSN
GSLTLAPKPGLGVEMNRDYLQNHEIELD
Download sequence
Identical sequences Q1MCH7
WP_011653299.1.53928 gi|116253604|ref|YP_769442.1| 216596.RL3864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]