SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 216596.RL4078 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  216596.RL4078
Domain Number - Region: 95-150
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00196
Family NfeD domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 216596.RL4078
Sequence length 151
Comment (Rhizobium leguminosarum bv viciae 3841)
Sequence
MLAKIVAELGPWSWWVAGLVLLAAEMIVPGFFLVWIGLAALIVGALSLLFWDSAFWVWEL
QAILFALLAVATTFAGRRLTLRNATTDEPFLNQRGASLVGRTATLHEPIREGRGRIRLDD
TLWQVMGPDLPVGTQVKVVSSNGRDLTVEPV
Download sequence
Identical sequences A0A198YV83 A0A1B1CBN3 J0V4C4 Q1MBW6
WP_003542867.1.100861 WP_003542867.1.21878 WP_003542867.1.53928 WP_003542867.1.54942 WP_003542867.1.62169 WP_003542867.1.70093 WP_003542867.1.78351 gi|116253815|ref|YP_769653.1| 216596.RL4078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]