SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 216596.pRL120179 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  216596.pRL120179
Domain Number 1 Region: 721-961
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 6.02e-26
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.019
Further Details:      
 
Domain Number 2 Region: 442-621
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.0000000000000091
Family PFOR PP module 0.095
Further Details:      
 
Domain Number 3 Region: 48-211
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 0.0000000000000942
Family Pyruvate oxidase and decarboxylase Pyr module 0.058
Further Details:      
 
Weak hits

Sequence:  216596.pRL120179
Domain Number - Region: 283-351
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.000314
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.031
Further Details:      
 
Domain Number - Region: 620-678
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.0279
Family Ferredoxin domains from multidomain proteins 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 216596.pRL120179
Sequence length 1156
Comment (Rhizobium leguminosarum bv viciae 3841)
Sequence
MSIHTQPDIPEPKISLDDRYTLERGRILVSGTQALVRLPMIQRQRDLARGLNTAGYVSGY
RGSPLAGFDREMARAKKFLDAAHVKFQPGLNEDMAATAVWGTQQTGMFQGLRYDGVFAMW
YGKGPGVDRSMDVIRHANAIGTNANGGVLLLVGDDHGAVSSTLPHQSEHNLISAMVPMLS
PAGIGEYIDYGLIGWAMSRYSGAWVGFKCQTEIVECSATVDLDPDRPLIVMPDDVFAPDG
LSLRWPDGPHAMELRLERKMLAVQAFARANHLDRAVWGATGRAKLGIVSTGKSWLDLLGA
LALLGIDQARAADLGLALYKVGMVWPLEPQGIAEFAARVDELLVVEEKRSILEDQIKAQL
FNLPADRRPSVFGKAGENGAPLLQAIGEIGTLSVAKAILSRLGDFDAALQAKARFVDEMA
LAMEIEATALKREAYFCSGCPHSVSTRLPEGSRASTGIGCHMMIIGNEDRNTSTFTQMGG
EGGSWIGLSPFTDEKHIFVNMGDGTYFHSGVLAIRAAIAAKVNATYKILYNDAVAMTGGQ
KHDGDVTVPGIVSQMLAEGATRVVVVAERPDVWQGNLPRAVSVHHRDELDAVQRELRDIP
GITVLIYDQVCAAEKRRRRKRGAYPVSDKRAFINELVCEGCGDCSAVSNCISIEPQETEF
GRKRRINQSSCNTDLSCIKGFCPSFVTVEGGSIRKPAAKSKSVKTDDLPLPVFTATFETP
YSMLLAGIGGTGVITVSAILAQAALLDGLALTTLDQTGLAQKNGSVVSHIRLANNPAQIH
AARVGPGESDLVLGFDIVVAAQKNSLTSFAKNKTRAVIDDHFAPTASFVKDTTIDFRQEA
TLKSLRRAAGDNAVETVAATDLATALMGDAVAANMFLLGHAWQRGLVPINLAAIDKAIEL
NGTGIAMNRAAFGWGRRAAVDIEAVAREARFVKAEPKAETLDEIVAKRVAFLTDYQSAAY
AKRYTDLVGVAASAEARLGGQTGFTEAVAKNAFRLMAYKDEYEVARLHRDRSFERKLSEQ
FEGDFKIKHHLAPPMISKIDRRTGHPAKIAFGAWIRPAFAVLEKLKFLRGTWLDPFGRTA
ERRLERQLIGDYVTLVIELSQSLDAGNPSVATELAGLPDMIRGFGHVKLASIQRFEKRKN
DLLAKWRASEPLTHVA
Download sequence
Identical sequences Q1M4S9
216596.pRL120179 gi|116248850|ref|YP_764691.1| WP_011648966.1.53928 gi|116248850|ref|YP_764691.1|NC_008378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]