SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 216596.pRL120784 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  216596.pRL120784
Domain Number 1 Region: 121-367
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 3.01e-71
Family D-glucarate dehydratase-like 0.00011
Further Details:      
 
Domain Number 2 Region: 1-133
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.97e-29
Family Enolase N-terminal domain-like 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 216596.pRL120784
Sequence length 403
Comment (Rhizobium leguminosarum bv viciae 3841)
Sequence
MKITGIRTFLMHVGQPDPANWASDQRSGGGASKQFGGTRNWLFLKIDTDEGITGIGECSG
WPRVVETAIHDLAPLLIGEDPAHTERLWQKMHIAMMGHGMLGTVGGGAMTGIDMALWDIK
GKALGVPVWMLLGGKVRDRIPIYSHANTPERALAIKTRGIKAIKCGGVADPVRKVAALRD
AVGDDMDIAIDLHGPPWLTPADACRLVRTLEPYELMWVEDPIAPENIDGYRRIRDAAHVP
LAAGERSATIFGERELIEKELVDVIQPDTGRAGGITQMKKIAAMAEAHHIQMAPHSGSLG
PVAEYAALHLLAAIPNALILERLDDDWDGRRQTIVPHPQQVDGLIAVPDGPGLGCDIDEA
FVARFPSNGNVSVPQSAGAYNPGTDNEHLYVQTRQSRRTYFNR
Download sequence
Identical sequences Q1M333
gi|116249446|ref|YP_765287.1| WP_011649532.1.53928 gi|116249446|ref|YP_765287.1|NC_008378 216596.pRL120784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]