SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 216895.VV1_0011 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  216895.VV1_0011
Domain Number 1 Region: 3-82
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000167
Family Anti-sigma factor antagonist SpoIIaa 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 216895.VV1_0011
Sequence length 357
Comment (Vibrio vulnificus CMCP6)
Sequence
MSENSLEIELDESITSEIVGNLWEKANRILDTHPNSAIVVNAHNLTFIDISGIAFLSDLQ
TRFRAPGAEISIVGLKPSLAELVPPAPVENNPSIVGRERGFFERVGRATKEMLIDVGSVA
RFVKDCAVVFKIGISRRKNVNWATVSDIASRAGADAVPIIMLIGFLMGVIIAFEIGLVAE
QFGAVLFVADGIGISMLRELGPLMTAIVFAGRTGAAFAAEIGTQKVNEEINALRTFGISP
VEFLVIPRIYASILVLPLLTVFADIIGVFGGALVLLKFDISFVQYYHQLLSALSIWDFGF
GLIKATTFGFIIAVIGCERGLATGQGSTSVGLAATSAVVSSIIWIVVIDGFFTVLLT
Download sequence
Identical sequences 216895.VV1_0011 gi|27363501|ref|NP_759029.1| WP_011078139.1.17874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]