SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 216895.VV1_3020 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  216895.VV1_3020
Domain Number 1 Region: 416-498
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000491
Family Anti-sigma factor antagonist SpoIIaa 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 216895.VV1_3020
Sequence length 519
Comment (Vibrio vulnificus CMCP6)
Sequence
MFEFPQFSKHSVKNDVLSGLTVALALVPEAVAFAFVAGVDPMVGLYAAFIVGLVTSIFGG
RPGMISGATGAMAVVMVSLVSSHGVQYLFAAIMLAGILQIAAGLFKLGKFIRIVPHPVMI
GFVNGLAIVIFLAQLGQFKMADAAGGLTWLPQDQMLLMLGLVALTMAIIHFLPKLTTAVP
SSLVAIVTVTGLVIGFDLETRTVVDFLRTMSGDEGATLAGSLPTFALPMVPFDLETLQII
FPYAVILAAIGLIESLLTLTVLDEMTNTRGQSNRECIGQGMANMTCSVFGAMGGCAMIGQ
SMINVNSGGRGRLSGIVAAVALLMFILFAAALIEMIPLAALVGVMFMVVIGTFEWATFKL
ARRVPKQDFFVIVLVTVVTVMTDLAVAVAVGVIASALMFAWNHAKHIYTDTRINEEGSKE
YKIHGPIFFGSTANFLELFNAQQDPSDVIVDFADSRVTDHSAIEAIETLAERYSAVGKTL
HLRHLSPDCRKLLDKAGSLVEINVKEDPSYKVATDVLAG
Download sequence
Identical sequences gi|27366290|ref|NP_761818.1| 216895.VV1_3020 WP_011080828.1.17874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]