SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 218491.ECA2864 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  218491.ECA2864
Domain Number - Region: 72-118
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00892
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 218491.ECA2864
Sequence length 141
Comment (Erwinia carotovora atroseptica SCRI1043)
Sequence
MRFLKCYLANNAKNRFVNATEASRLPQGHWTCTSCGCTLTLHNGSQCQEAWFEHDRFSID
SRKLKACAYRDPEEKEEERIKKLREKIRASYALPEPNTWYCVLCQNRYTGKKLCPACKDG
IYSVVVEENGYVPEEEGHRNS
Download sequence
Identical sequences Q6D380
WP_011094397.1.79946 218491.ECA2864 gi|50121788|ref|YP_050955.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]