SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 218491.ECA3221 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  218491.ECA3221
Domain Number 1 Region: 14-56
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0000000121
Family Phage repressors 0.058
Further Details:      
 
Weak hits

Sequence:  218491.ECA3221
Domain Number - Region: 132-290
Classification Level Classification E-value
Superfamily Phase 1 flagellin 0.0772
Family Phase 1 flagellin 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 218491.ECA3221
Sequence length 332
Comment (Erwinia carotovora atroseptica SCRI1043)
Sequence
MNTETTQDTTEAKLPGERLREARERLGLTQQTIAERLCLKITTVRDIEDGTTPADLAPTF
LRGYIRSYAKLVHLPEDNLLPIMDKQAVPKAISVSPMQSFSLKKSRKKRDGWLMIITWLV
VLVVLGLTGAWWWQNHQAQQAEINSMVDHASSMQSQTEGQSVPLMDNSAPQETSTAGSAA
TPPSTPVDLSATIAATPSTPPSSTTASSAAPSSQSPSQANATQSQAAGNALLGAGAVAPA
ATVADSNPVSAAHALVMTFTADCWLEVTDVSGKKLFSGMQRNGSTLNLDGQSPYQLKIGA
PAAVQIKFQGKPVDLSRFVRSSQVARLTLTAE
Download sequence
Identical sequences Q6D275
gi|50122143|ref|YP_051310.1| WP_011094742.1.79946 218491.ECA3221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]