SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 218495.SUB0372 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  218495.SUB0372
Domain Number - Region: 230-316
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00337
Family Voltage-gated potassium channels 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 218495.SUB0372
Sequence length 458
Comment (Streptococcus uberis 0140J)
Sequence
MFFSWIRTWSITRRLTFSFALVILIGSILLSLPFFQYQNASESVYLDHLFNVVSMVCVTG
LSVIPISEVYNGFGQMVAIILMQIGGLGLVTLIAFSTFALQKKMDLSGHSLLQSALNRND
STNLKHYLFFAYKVTFAIESIAFLVILTDFIPRFGLKNGIFNSLFLAVSAFCNAGFDNFG
SNSLTDFVVNPTINFVVALLIIFGGIGFAVWYDLSNNLKRYFYDKPKCHGLFYQKLSNQT
RLILQTTLIILITGTLITWFLEKDNPNTIANYNLWQQLMVSFFQTVTMRTAGFATLSYTD
TLAPTNFLYMIQMIIGGAPGGTAGGVKVTTVAIVFLLLKSELKAQSQVTFHHRMIASKTV
KQTMSVLIFFFTILTIGYILLLAVEPYIDPVALLFEAISAIDTVGVTMNVTPKLSTPGRI
IIMLLMFIGRVGPITFLLSLIARKEKTIRYATTDILVG
Download sequence
Identical sequences B9DTP2
218495.SUB0372 WP_012657908.1.37397 WP_012657908.1.51754 WP_012657908.1.65710 WP_012657908.1.69183 WP_012657908.1.69259 WP_012657908.1.70036 WP_012657908.1.70882 WP_012657908.1.78160 WP_012657908.1.84361 WP_012657908.1.93969 WP_012657908.1.94620 gi|222152551|ref|YP_002561726.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]