SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 218495.SUB0655 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  218495.SUB0655
Domain Number 1 Region: 139-433
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 7.21e-125
Family Enolase 0.000000000201
Further Details:      
 
Domain Number 2 Region: 3-138
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 7.66e-58
Family Enolase N-terminal domain-like 0.000000201
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 218495.SUB0655
Sequence length 435
Comment (Streptococcus uberis 0140J)
Sequence
MSIITDVYAREVLDSRGNPTLEVEVYTESGAFGRGMVPSGASTGEHEAVELRDGDKSRYN
GLGTEKAVDNVNNIIAEAIIGYDVRDQQAIDRAMIALDGTPNKGKLGANAILGVSIAVAR
AAADYLEVPLYNYLGGFNTKVLPTPMMNIVNGGSHSDAPIAFQEFMIMPVGASTFKEALR
WGAEVFHALKKILKERGLETAVGDEGGFAPKFEGTEDGVETILKAIEAAGYEAGENGIMI
GFDCASSEFYDKERKVYDYTKFEGEGAAVRTSAEQIDYLEELVNKYPIITIEDGMDENDW
DGWKALTERLGGRVQLVGDDFFVTNTDYLARGIKEEAANSILIKVNQIGTLTETFEAIEM
AKEAGYTAVVSHRSGETEDSTIADIAVATNAGQIKTGSLSRTDRIAKYNQLLRIEDQLGE
VAQYKGIKSFYNLKK
Download sequence
Identical sequences B9DRR9
gi|222152817|ref|YP_002561994.1| 218495.SUB0655 WP_012658173.1.37397 WP_012658173.1.4990 WP_012658173.1.51754 WP_012658173.1.65710 WP_012658173.1.69183 WP_012658173.1.69259 WP_012658173.1.70036 WP_012658173.1.70882 WP_012658173.1.78160 WP_012658173.1.84361 WP_012658173.1.87423 WP_012658173.1.93969 WP_012658173.1.94620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]