SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 218497.CAB825 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  218497.CAB825
Domain Number 1 Region: 1-107
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.71e-23
Family Anti-sigma factor antagonist SpoIIaa 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 218497.CAB825
Sequence length 110
Comment (Chlamydophila abortus S26 3)
Sequence
MDWLTKQYGDVLVVSLEGALDAVSVPKAEAFLNKKVAEGKHKIVLNFQYVTYMSSAGIRL
VFSLSKSLQACQGLLCICCVSNVVADVIRIAGVDQLLPVCQSEQECFTKF
Download sequence
Identical sequences A0A1X6TF37 Q5L529
gi|62185428|ref|YP_220213.1| 218497.CAB825 WP_006344430.1.109 WP_006344430.1.11364 WP_006344430.1.14083 WP_006344430.1.14344 WP_006344430.1.14517 WP_006344430.1.15032 WP_006344430.1.1879 WP_006344430.1.22818 WP_006344430.1.23093 WP_006344430.1.23350 WP_006344430.1.26184 WP_006344430.1.32323 WP_006344430.1.36616 WP_006344430.1.42032 WP_006344430.1.4280 WP_006344430.1.44888 WP_006344430.1.44963 WP_006344430.1.4586 WP_006344430.1.48359 WP_006344430.1.49322 WP_006344430.1.49966 WP_006344430.1.54567 WP_006344430.1.54594 WP_006344430.1.55182 WP_006344430.1.56716 WP_006344430.1.62355 WP_006344430.1.6521 WP_006344430.1.66406 WP_006344430.1.67892 WP_006344430.1.70375 WP_006344430.1.7272 WP_006344430.1.77225 WP_006344430.1.80513 WP_006344430.1.82922 WP_006344430.1.85140 WP_006344430.1.86343 WP_006344430.1.87259 WP_006344430.1.89149 WP_006344430.1.92051 WP_006344430.1.99375 WP_006344430.1.99796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]