SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 218497.CAB932 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  218497.CAB932
Domain Number 1 Region: 142-421
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 5.38e-118
Family Enolase 0.0000000557
Further Details:      
 
Domain Number 2 Region: 5-140
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.66e-50
Family Enolase N-terminal domain-like 0.0000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 218497.CAB932
Sequence length 424
Comment (Chlamydophila abortus S26 3)
Sequence
MLEVVISDIQAREILDSRGYPTLYVKVITNTGTFGEACVPSGASTGIKEALELRDQDTSR
YQGKGVLQALKNVKEVLLPVLQGVSIFDQILIDSIMVEADGTPNKEKLGANAILGVSLAA
AKAAAATLGRSFYRYVGGCFAHILPCPMMNLINGGMHANNGLQFQEFMIRPIGAHSLQEA
VRMGADVFHTLKNLLNDKHLATGVGDEGGFAPQLKSNSEALDLLVLAIEKAGFQPGEEIS
LALDCAASSFYDTKTETYAGKNSQEQVGILADLCDRYPIDSIEDGLAEEDFDGWELLTAE
LGENIQIVGDDLFVTNPELIAEGISKGLANAVLIKPNQIGTLTETSEAIQLAHSQGYTTI
LSHRSGETEDTTIADLAVAFNTGQIKTGSLSRSERIAKYNRLMAIEEELGSEGLFKDSNP
FSGE
Download sequence
Identical sequences A0A1X6VIU9 Q5L4S5
WP_011097432.1.109 WP_011097432.1.11364 WP_011097432.1.14083 WP_011097432.1.14344 WP_011097432.1.14517 WP_011097432.1.15032 WP_011097432.1.1879 WP_011097432.1.22818 WP_011097432.1.23093 WP_011097432.1.23350 WP_011097432.1.26184 WP_011097432.1.32323 WP_011097432.1.36616 WP_011097432.1.42032 WP_011097432.1.44888 WP_011097432.1.44963 WP_011097432.1.4586 WP_011097432.1.46162 WP_011097432.1.46624 WP_011097432.1.48359 WP_011097432.1.49966 WP_011097432.1.54567 WP_011097432.1.54594 WP_011097432.1.55182 WP_011097432.1.56716 WP_011097432.1.59503 WP_011097432.1.60858 WP_011097432.1.62355 WP_011097432.1.6521 WP_011097432.1.66261 WP_011097432.1.66406 WP_011097432.1.67892 WP_011097432.1.70375 WP_011097432.1.7272 WP_011097432.1.77225 WP_011097432.1.80513 WP_011097432.1.82153 WP_011097432.1.82677 WP_011097432.1.82922 WP_011097432.1.85140 WP_011097432.1.85143 WP_011097432.1.86343 WP_011097432.1.87259 WP_011097432.1.89149 WP_011097432.1.92051 WP_011097432.1.96891 WP_011097432.1.99375 WP_011097432.1.99796 218497.CAB932 gi|62185532|ref|YP_220317.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]