SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 220341.STY1419 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  220341.STY1419
Domain Number 1 Region: 794-1162
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 8.57e-117
Family PFOR PP module 0.0000000366
Further Details:      
 
Domain Number 2 Region: 419-668
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 5.36e-75
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.00000114
Further Details:      
 
Domain Number 3 Region: 2-254
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.87e-73
Family PFOR Pyr module 0.0000001
Further Details:      
 
Domain Number 4 Region: 256-411
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 2.14e-43
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.0000221
Further Details:      
 
Domain Number 5 Region: 665-838
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 5.44e-23
Family Ferredoxin domains from multidomain proteins 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 220341.STY1419
Sequence length 1174
Comment (Salmonella typhi)
Sequence
MQTIDGNGAVASVAFRTSEVIAIYPITPSSTMAEQADAWAGNGLKNVWGDTPRVVEMQSE
GGAIAAVHGALQTGSLSTSFTSSQGLLLMIPTLYKLAGQLTPFVLHVAARTVATHALSIF
GDHSDVMAVRQTGCAMLCAASVQEAQDFALIAHRATLKSRVPFIHFFDGFRTSHEINKII
PLTDETILNLMPQAEIDAHRARALNPEHPVIRGTSANPDTYFQSREATNPWYNAVYDHVE
EAMKAFGDATGRQYQPFEYYGHPQAERVIIMMGSALGTCEEVVDELLIRGEKVGVLKVRL
FRPFSAKHLLQALPETVRAIAVLDRTKEPGAQAEPLYLDVMTALAEAFNNGERETLPRTI
GGRYGLSSKEFGPACVLAVFNELSRAKPKPRFTVGIYDDVTNLSLPLPENTLPGSAKLEA
LFYGLGSDGSVSATKNNIKIIGNSTPWYAQGYFVYDSKKAGGLTVSHLRVSEKPIRSAYL
IAQADFVGCHQLQFIDKYQMAERLKPGGIFLLNTPYSADEVWSRLPQEVQAVLNQKKARF
YVVNAAKIARECGLGARINTVMQMAFFHLTHILPGDSALVELQGAIAKSYSSKGQDLVER
NWQALALAQESLAEVPLQAVNPHSAHRPPVVSDAAPDFVKTVTAAMLAGLGDALPVSALP
PDGTWPMGTTRWEKRNIAEEIPVWKEELCTQCNHCVAACPHSAIRAKVVSPQAMENAPAS
LHSLDVKSRDMRGQKYVLQVAPEDCTGCNLCVEVCPAKDRQNPQIKAINMMSRLEHVEEE
KVNYDFFLDLPEIDRSKLERIDIRTSQLITPLFEYSGACSGCGETPYIKLLTQLYGDRML
IANATGCSSIYGGNLPSTPYTTDANGRGPAWTNSLFEDNAEFGLGFRLSVDQHRARVMRL
LAQFADRIPAELNDALHAEATPDVRREQVAALRQHLKSVAGAEELLKDADALVEKSIWLI
GGDGWAYDIGFGGLDHVLSLTENVNILVLDTQCYSNTGGQASKATPLGAVTKFGEHGKRK
ARKDLGVSMMMYGHVYVAQISLGAQLNQTVKAIQEAEAWPGPSLIIAYSPCEEHGYDLAL
SHDQMRQLTATGFWPLYRFDPRRADEGKPPLALDSRPPSDALAETLLNEQRFRRLNAQQP
EVAEQLWRDAALDLQKRYDFLALLAGKAEKPSAD
Download sequence
Identical sequences Q8Z781
gi|29141994|ref|NP_805336.1| gi|378959714|ref|YP_005217200.1| 209261.t1553 220341.STY1419 gi|16760237|ref|NP_455854.1| NP_455854.1.84458 WP_001193255.1.100008 WP_001193255.1.100036 WP_001193255.1.100079 WP_001193255.1.100196 WP_001193255.1.100284 WP_001193255.1.100313 WP_001193255.1.100314 WP_001193255.1.100321 WP_001193255.1.100354 WP_001193255.1.100421 WP_001193255.1.100446 WP_001193255.1.100450 WP_001193255.1.100592 WP_001193255.1.100610 WP_001193255.1.100732 WP_001193255.1.100733 WP_001193255.1.100739 WP_001193255.1.100764 WP_001193255.1.100799 WP_001193255.1.100941 WP_001193255.1.100953 WP_001193255.1.10108 WP_001193255.1.101226 WP_001193255.1.10124 WP_001193255.1.101312 WP_001193255.1.101322 WP_001193255.1.101616 WP_001193255.1.101890 WP_001193255.1.102050 WP_001193255.1.102087 WP_001193255.1.10338 WP_001193255.1.1038 WP_001193255.1.104 WP_001193255.1.10401 WP_001193255.1.10428 WP_001193255.1.10459 WP_001193255.1.10511 WP_001193255.1.10514 WP_001193255.1.10530 WP_001193255.1.10532 WP_001193255.1.10547 WP_001193255.1.10595 WP_001193255.1.10642 WP_001193255.1.10654 WP_001193255.1.10677 WP_001193255.1.10857 WP_001193255.1.10873 WP_001193255.1.10926 WP_001193255.1.10936 WP_001193255.1.11012 WP_001193255.1.11055 WP_001193255.1.11126 WP_001193255.1.11142 WP_001193255.1.11239 WP_001193255.1.11253 WP_001193255.1.11314 WP_001193255.1.1142 WP_001193255.1.11426 WP_001193255.1.11429 WP_001193255.1.11557 WP_001193255.1.11567 WP_001193255.1.11638 WP_001193255.1.11883 WP_001193255.1.11908 WP_001193255.1.11914 WP_001193255.1.12040 WP_001193255.1.12061 WP_001193255.1.1207 WP_001193255.1.12141 WP_001193255.1.12172 WP_001193255.1.12192 WP_001193255.1.1224 WP_001193255.1.12364 WP_001193255.1.12398 WP_001193255.1.12441 WP_001193255.1.12581 WP_001193255.1.12620 WP_001193255.1.12648 WP_001193255.1.12683 WP_001193255.1.12726 WP_001193255.1.12727 WP_001193255.1.12741 WP_001193255.1.12834 WP_001193255.1.13108 WP_001193255.1.13161 WP_001193255.1.1321 WP_001193255.1.13268 WP_001193255.1.13291 WP_001193255.1.133 WP_001193255.1.13314 WP_001193255.1.13338 WP_001193255.1.13352 WP_001193255.1.13406 WP_001193255.1.13440 WP_001193255.1.13443 WP_001193255.1.13476 WP_001193255.1.13599 WP_001193255.1.13686 WP_001193255.1.1372 WP_001193255.1.13732 WP_001193255.1.1382 WP_001193255.1.1397 WP_001193255.1.13972 WP_001193255.1.140 WP_001193255.1.1401 WP_001193255.1.1408 WP_001193255.1.14089 WP_001193255.1.14099 WP_001193255.1.14120 WP_001193255.1.14123 WP_001193255.1.14150 WP_001193255.1.14191 WP_001193255.1.14197 WP_001193255.1.14280 WP_001193255.1.14333 WP_001193255.1.14444 WP_001193255.1.14467 WP_001193255.1.14474 WP_001193255.1.14500 WP_001193255.1.14526 WP_001193255.1.14550 WP_001193255.1.14575 WP_001193255.1.14703 WP_001193255.1.14719 WP_001193255.1.1473 WP_001193255.1.14765 WP_001193255.1.14810 WP_001193255.1.14877 WP_001193255.1.14894 WP_001193255.1.14930 WP_001193255.1.14947 WP_001193255.1.14948 WP_001193255.1.15184 WP_001193255.1.15244 WP_001193255.1.15265 WP_001193255.1.15362 WP_001193255.1.15415 WP_001193255.1.15423 WP_001193255.1.15433 WP_001193255.1.15439 WP_001193255.1.15535 WP_001193255.1.15581 WP_001193255.1.15710 WP_001193255.1.15717 WP_001193255.1.15905 WP_001193255.1.15912 WP_001193255.1.15970 WP_001193255.1.16046 WP_001193255.1.16051 WP_001193255.1.16058 WP_001193255.1.16150 WP_001193255.1.16155 WP_001193255.1.1626 WP_001193255.1.16264 WP_001193255.1.16452 WP_001193255.1.16461 WP_001193255.1.16462 WP_001193255.1.16465 WP_001193255.1.16522 WP_001193255.1.16588 WP_001193255.1.16658 WP_001193255.1.16666 WP_001193255.1.16673 WP_001193255.1.1674 WP_001193255.1.16767 WP_001193255.1.16781 WP_001193255.1.16879 WP_001193255.1.16893 WP_001193255.1.16905 WP_001193255.1.16948 WP_001193255.1.17049 WP_001193255.1.17058 WP_001193255.1.17078 WP_001193255.1.17202 WP_001193255.1.17219 WP_001193255.1.1722 WP_001193255.1.17302 WP_001193255.1.17308 WP_001193255.1.17368 WP_001193255.1.17405 WP_001193255.1.17406 WP_001193255.1.17513 WP_001193255.1.17543 WP_001193255.1.17578 WP_001193255.1.17622 WP_001193255.1.17659 WP_001193255.1.17667 WP_001193255.1.17686 WP_001193255.1.17741 WP_001193255.1.17840 WP_001193255.1.17956 WP_001193255.1.18005 WP_001193255.1.1801 WP_001193255.1.18021 WP_001193255.1.18099 WP_001193255.1.18124 WP_001193255.1.18144 WP_001193255.1.18173 WP_001193255.1.18270 WP_001193255.1.18280 WP_001193255.1.18328 WP_001193255.1.18358 WP_001193255.1.18370 WP_001193255.1.18406 WP_001193255.1.18474 WP_001193255.1.18513 WP_001193255.1.18610 WP_001193255.1.18678 WP_001193255.1.18722 WP_001193255.1.18766 WP_001193255.1.1880 WP_001193255.1.1885 WP_001193255.1.18860 WP_001193255.1.18922 WP_001193255.1.18959 WP_001193255.1.19006 WP_001193255.1.19044 WP_001193255.1.19084 WP_001193255.1.19187 WP_001193255.1.19228 WP_001193255.1.19288 WP_001193255.1.19300 WP_001193255.1.19422 WP_001193255.1.19454 WP_001193255.1.19456 WP_001193255.1.19496 WP_001193255.1.19535 WP_001193255.1.19538 WP_001193255.1.19589 WP_001193255.1.19663 WP_001193255.1.19686 WP_001193255.1.19731 WP_001193255.1.19794 WP_001193255.1.1992 WP_001193255.1.19999 WP_001193255.1.20254 WP_001193255.1.20255 WP_001193255.1.20296 WP_001193255.1.20339 WP_001193255.1.20419 WP_001193255.1.20465 WP_001193255.1.20492 WP_001193255.1.2053 WP_001193255.1.20635 WP_001193255.1.20718 WP_001193255.1.20740 WP_001193255.1.20828 WP_001193255.1.2087 WP_001193255.1.20883 WP_001193255.1.20947 WP_001193255.1.20953 WP_001193255.1.21010 WP_001193255.1.2106 WP_001193255.1.21062 WP_001193255.1.21144 WP_001193255.1.21184 WP_001193255.1.21185 WP_001193255.1.21366 WP_001193255.1.21492 WP_001193255.1.2166 WP_001193255.1.21674 WP_001193255.1.21966 WP_001193255.1.22064 WP_001193255.1.22118 WP_001193255.1.22126 WP_001193255.1.2216 WP_001193255.1.22208 WP_001193255.1.2227 WP_001193255.1.22373 WP_001193255.1.22614 WP_001193255.1.22652 WP_001193255.1.22683 WP_001193255.1.2284 WP_001193255.1.22895 WP_001193255.1.22926 WP_001193255.1.22943 WP_001193255.1.22967 WP_001193255.1.23040 WP_001193255.1.23058 WP_001193255.1.23218 WP_001193255.1.2331 WP_001193255.1.2332 WP_001193255.1.23340 WP_001193255.1.2336 WP_001193255.1.23365 WP_001193255.1.23412 WP_001193255.1.23426 WP_001193255.1.23492 WP_001193255.1.23515 WP_001193255.1.23548 WP_001193255.1.23571 WP_001193255.1.23604 WP_001193255.1.23679 WP_001193255.1.23728 WP_001193255.1.2375 WP_001193255.1.23783 WP_001193255.1.23786 WP_001193255.1.23787 WP_001193255.1.23801 WP_001193255.1.24028 WP_001193255.1.24061 WP_001193255.1.24083 WP_001193255.1.24117 WP_001193255.1.24125 WP_001193255.1.24138 WP_001193255.1.24153 WP_001193255.1.24291 WP_001193255.1.24322 WP_001193255.1.24355 WP_001193255.1.24375 WP_001193255.1.24400 WP_001193255.1.24420 WP_001193255.1.24619 WP_001193255.1.24643 WP_001193255.1.24688 WP_001193255.1.24716 WP_001193255.1.2481 WP_001193255.1.24832 WP_001193255.1.24964 WP_001193255.1.25017 WP_001193255.1.25032 WP_001193255.1.25041 WP_001193255.1.25053 WP_001193255.1.25140 WP_001193255.1.25185 WP_001193255.1.25196 WP_001193255.1.25210 WP_001193255.1.25219 WP_001193255.1.25304 WP_001193255.1.25374 WP_001193255.1.25475 WP_001193255.1.25490 WP_001193255.1.25508 WP_001193255.1.25512 WP_001193255.1.25603 WP_001193255.1.2562 WP_001193255.1.25666 WP_001193255.1.25807 WP_001193255.1.25821 WP_001193255.1.25833 WP_001193255.1.25835 WP_001193255.1.25882 WP_001193255.1.25911 WP_001193255.1.25962 WP_001193255.1.25963 WP_001193255.1.26001 WP_001193255.1.26027 WP_001193255.1.26107 WP_001193255.1.2615 WP_001193255.1.26217 WP_001193255.1.26230 WP_001193255.1.26232 WP_001193255.1.26272 WP_001193255.1.26286 WP_001193255.1.26288 WP_001193255.1.26394 WP_001193255.1.26491 WP_001193255.1.2654 WP_001193255.1.26554 WP_001193255.1.26636 WP_001193255.1.26689 WP_001193255.1.2679 WP_001193255.1.26908 WP_001193255.1.2692 WP_001193255.1.26928 WP_001193255.1.270 WP_001193255.1.27008 WP_001193255.1.27027 WP_001193255.1.27070 WP_001193255.1.27077 WP_001193255.1.27086 WP_001193255.1.27087 WP_001193255.1.27111 WP_001193255.1.27115 WP_001193255.1.2713 WP_001193255.1.2717 WP_001193255.1.27228 WP_001193255.1.27282 WP_001193255.1.27285 WP_001193255.1.27309 WP_001193255.1.27329 WP_001193255.1.27361 WP_001193255.1.27565 WP_001193255.1.27595 WP_001193255.1.27598 WP_001193255.1.27706 WP_001193255.1.27775 WP_001193255.1.27785 WP_001193255.1.27900 WP_001193255.1.27928 WP_001193255.1.27945 WP_001193255.1.28004 WP_001193255.1.2809 WP_001193255.1.28155 WP_001193255.1.28198 WP_001193255.1.2822 WP_001193255.1.28229 WP_001193255.1.28384 WP_001193255.1.28386 WP_001193255.1.28395 WP_001193255.1.284 WP_001193255.1.2845 WP_001193255.1.28479 WP_001193255.1.28627 WP_001193255.1.28692 WP_001193255.1.2873 WP_001193255.1.28917 WP_001193255.1.28962 WP_001193255.1.29023 WP_001193255.1.29042 WP_001193255.1.2905 WP_001193255.1.2907 WP_001193255.1.29081 WP_001193255.1.29089 WP_001193255.1.29153 WP_001193255.1.29203 WP_001193255.1.29237 WP_001193255.1.29248 WP_001193255.1.29288 WP_001193255.1.29389 WP_001193255.1.29439 WP_001193255.1.2946 WP_001193255.1.29462 WP_001193255.1.29563 WP_001193255.1.29727 WP_001193255.1.29743 WP_001193255.1.29782 WP_001193255.1.29833 WP_001193255.1.29851 WP_001193255.1.29865 WP_001193255.1.29886 WP_001193255.1.29919 WP_001193255.1.2994 WP_001193255.1.29964 WP_001193255.1.29983 WP_001193255.1.30009 WP_001193255.1.30013 WP_001193255.1.3002 WP_001193255.1.30034 WP_001193255.1.30049 WP_001193255.1.30058 WP_001193255.1.30172 WP_001193255.1.30185 WP_001193255.1.30354 WP_001193255.1.30357 WP_001193255.1.30362 WP_001193255.1.3042 WP_001193255.1.30421 WP_001193255.1.30440 WP_001193255.1.30448 WP_001193255.1.30489 WP_001193255.1.30517 WP_001193255.1.30542 WP_001193255.1.30544 WP_001193255.1.30556 WP_001193255.1.30572 WP_001193255.1.30585 WP_001193255.1.30618 WP_001193255.1.30664 WP_001193255.1.30688 WP_001193255.1.30806 WP_001193255.1.30967 WP_001193255.1.31046 WP_001193255.1.31078 WP_001193255.1.31139 WP_001193255.1.31145 WP_001193255.1.31182 WP_001193255.1.31205 WP_001193255.1.3121 WP_001193255.1.31223 WP_001193255.1.31303 WP_001193255.1.3131 WP_001193255.1.31352 WP_001193255.1.31389 WP_001193255.1.31413 WP_001193255.1.31533 WP_001193255.1.31799 WP_001193255.1.31836 WP_001193255.1.31951 WP_001193255.1.32041 WP_001193255.1.32042 WP_001193255.1.3207 WP_001193255.1.32189 WP_001193255.1.32202 WP_001193255.1.32263 WP_001193255.1.32293 WP_001193255.1.32299 WP_001193255.1.32422 WP_001193255.1.32425 WP_001193255.1.32458 WP_001193255.1.32460 WP_001193255.1.32529 WP_001193255.1.32563 WP_001193255.1.32578 WP_001193255.1.32617 WP_001193255.1.3270 WP_001193255.1.32725 WP_001193255.1.32838 WP_001193255.1.32848 WP_001193255.1.32868 WP_001193255.1.32940 WP_001193255.1.3296 WP_001193255.1.32966 WP_001193255.1.32985 WP_001193255.1.33037 WP_001193255.1.3305 WP_001193255.1.33051 WP_001193255.1.33065 WP_001193255.1.33122 WP_001193255.1.3315 WP_001193255.1.33214 WP_001193255.1.33247 WP_001193255.1.33280 WP_001193255.1.33283 WP_001193255.1.33339 WP_001193255.1.33382 WP_001193255.1.33490 WP_001193255.1.33501 WP_001193255.1.33529 WP_001193255.1.33689 WP_001193255.1.3370 WP_001193255.1.33730 WP_001193255.1.33741 WP_001193255.1.33840 WP_001193255.1.3392 WP_001193255.1.33926 WP_001193255.1.33957 WP_001193255.1.33969 WP_001193255.1.34001 WP_001193255.1.34059 WP_001193255.1.34118 WP_001193255.1.34211 WP_001193255.1.34214 WP_001193255.1.34234 WP_001193255.1.34284 WP_001193255.1.34376 WP_001193255.1.34382 WP_001193255.1.34484 WP_001193255.1.34517 WP_001193255.1.34530 WP_001193255.1.34665 WP_001193255.1.34694 WP_001193255.1.34751 WP_001193255.1.34808 WP_001193255.1.34824 WP_001193255.1.34932 WP_001193255.1.35001 WP_001193255.1.35040 WP_001193255.1.35074 WP_001193255.1.35175 WP_001193255.1.35240 WP_001193255.1.35274 WP_001193255.1.35532 WP_001193255.1.35560 WP_001193255.1.3557 WP_001193255.1.35628 WP_001193255.1.3570 WP_001193255.1.35712 WP_001193255.1.35713 WP_001193255.1.35736 WP_001193255.1.35791 WP_001193255.1.35795 WP_001193255.1.35870 WP_001193255.1.35916 WP_001193255.1.35938 WP_001193255.1.35966 WP_001193255.1.36000 WP_001193255.1.36034 WP_001193255.1.36036 WP_001193255.1.36069 WP_001193255.1.36291 WP_001193255.1.36298 WP_001193255.1.36308 WP_001193255.1.36323 WP_001193255.1.36343 WP_001193255.1.36460 WP_001193255.1.3649 WP_001193255.1.36526 WP_001193255.1.36567 WP_001193255.1.36617 WP_001193255.1.36618 WP_001193255.1.36643 WP_001193255.1.36701 WP_001193255.1.36725 WP_001193255.1.36779 WP_001193255.1.36798 WP_001193255.1.36821 WP_001193255.1.36853 WP_001193255.1.36950 WP_001193255.1.37014 WP_001193255.1.37133 WP_001193255.1.37176 WP_001193255.1.37199 WP_001193255.1.37200 WP_001193255.1.37258 WP_001193255.1.37303 WP_001193255.1.37513 WP_001193255.1.37584 WP_001193255.1.37590 WP_001193255.1.37593 WP_001193255.1.37600 WP_001193255.1.37613 WP_001193255.1.37659 WP_001193255.1.37662 WP_001193255.1.37675 WP_001193255.1.37691 WP_001193255.1.37761 WP_001193255.1.37775 WP_001193255.1.37777 WP_001193255.1.378 WP_001193255.1.379 WP_001193255.1.37911 WP_001193255.1.37985 WP_001193255.1.38061 WP_001193255.1.38064 WP_001193255.1.3816 WP_001193255.1.38207 WP_001193255.1.38261 WP_001193255.1.38266 WP_001193255.1.38310 WP_001193255.1.3834 WP_001193255.1.38351 WP_001193255.1.3838 WP_001193255.1.38381 WP_001193255.1.38440 WP_001193255.1.38486 WP_001193255.1.38595 WP_001193255.1.3860 WP_001193255.1.38642 WP_001193255.1.38734 WP_001193255.1.38877 WP_001193255.1.38983 WP_001193255.1.39056 WP_001193255.1.3907 WP_001193255.1.39105 WP_001193255.1.3914 WP_001193255.1.39147 WP_001193255.1.39161 WP_001193255.1.39210 WP_001193255.1.39235 WP_001193255.1.3931 WP_001193255.1.39435 WP_001193255.1.39502 WP_001193255.1.39619 WP_001193255.1.39620 WP_001193255.1.39624 WP_001193255.1.39659 WP_001193255.1.39775 WP_001193255.1.39879 WP_001193255.1.39941 WP_001193255.1.39945 WP_001193255.1.39947 WP_001193255.1.40095 WP_001193255.1.40097 WP_001193255.1.401 WP_001193255.1.40160 WP_001193255.1.40167 WP_001193255.1.40279 WP_001193255.1.40361 WP_001193255.1.4042 WP_001193255.1.40467 WP_001193255.1.40496 WP_001193255.1.40517 WP_001193255.1.40698 WP_001193255.1.40750 WP_001193255.1.40763 WP_001193255.1.40854 WP_001193255.1.4089 WP_001193255.1.40924 WP_001193255.1.40932 WP_001193255.1.40946 WP_001193255.1.41004 WP_001193255.1.4106 WP_001193255.1.41070 WP_001193255.1.41074 WP_001193255.1.41075 WP_001193255.1.41097 WP_001193255.1.41132 WP_001193255.1.41176 WP_001193255.1.41251 WP_001193255.1.41258 WP_001193255.1.41305 WP_001193255.1.41321 WP_001193255.1.41333 WP_001193255.1.41335 WP_001193255.1.4136 WP_001193255.1.41415 WP_001193255.1.41459 WP_001193255.1.41498 WP_001193255.1.41519 WP_001193255.1.41524 WP_001193255.1.41658 WP_001193255.1.41716 WP_001193255.1.41824 WP_001193255.1.41825 WP_001193255.1.41894 WP_001193255.1.41919 WP_001193255.1.41929 WP_001193255.1.4194 WP_001193255.1.42069 WP_001193255.1.42081 WP_001193255.1.42090 WP_001193255.1.42111 WP_001193255.1.42187 WP_001193255.1.42200 WP_001193255.1.42219 WP_001193255.1.42257 WP_001193255.1.42261 WP_001193255.1.42349 WP_001193255.1.42364 WP_001193255.1.42371 WP_001193255.1.42379 WP_001193255.1.42391 WP_001193255.1.42399 WP_001193255.1.42539 WP_001193255.1.42603 WP_001193255.1.42650 WP_001193255.1.4267 WP_001193255.1.42701 WP_001193255.1.42805 WP_001193255.1.42815 WP_001193255.1.42859 WP_001193255.1.4298 WP_001193255.1.43008 WP_001193255.1.43019 WP_001193255.1.43065 WP_001193255.1.43068 WP_001193255.1.43069 WP_001193255.1.43128 WP_001193255.1.43141 WP_001193255.1.43157 WP_001193255.1.43190 WP_001193255.1.43198 WP_001193255.1.4326 WP_001193255.1.43290 WP_001193255.1.43292 WP_001193255.1.43307 WP_001193255.1.43637 WP_001193255.1.43651 WP_001193255.1.43722 WP_001193255.1.43801 WP_001193255.1.43812 WP_001193255.1.43878 WP_001193255.1.43888 WP_001193255.1.43919 WP_001193255.1.43974 WP_001193255.1.44049 WP_001193255.1.44101 WP_001193255.1.44160 WP_001193255.1.44180 WP_001193255.1.44196 WP_001193255.1.44248 WP_001193255.1.44262 WP_001193255.1.44268 WP_001193255.1.4427 WP_001193255.1.44296 WP_001193255.1.44343 WP_001193255.1.44360 WP_001193255.1.44416 WP_001193255.1.44431 WP_001193255.1.44437 WP_001193255.1.44546 WP_001193255.1.4468 WP_001193255.1.44762 WP_001193255.1.44815 WP_001193255.1.44828 WP_001193255.1.44879 WP_001193255.1.44917 WP_001193255.1.4501 WP_001193255.1.45072 WP_001193255.1.45093 WP_001193255.1.45136 WP_001193255.1.45435 WP_001193255.1.45523 WP_001193255.1.45596 WP_001193255.1.45648 WP_001193255.1.45829 WP_001193255.1.45871 WP_001193255.1.46030 WP_001193255.1.46077 WP_001193255.1.46169 WP_001193255.1.46225 WP_001193255.1.46241 WP_001193255.1.46355 WP_001193255.1.464 WP_001193255.1.46454 WP_001193255.1.46461 WP_001193255.1.46504 WP_001193255.1.46505 WP_001193255.1.46551 WP_001193255.1.46559 WP_001193255.1.46701 WP_001193255.1.46781 WP_001193255.1.46816 WP_001193255.1.46842 WP_001193255.1.46920 WP_001193255.1.46945 WP_001193255.1.47036 WP_001193255.1.47037 WP_001193255.1.47042 WP_001193255.1.47059 WP_001193255.1.47085 WP_001193255.1.47123 WP_001193255.1.47215 WP_001193255.1.47245 WP_001193255.1.47523 WP_001193255.1.47531 WP_001193255.1.47532 WP_001193255.1.47630 WP_001193255.1.47756 WP_001193255.1.4781 WP_001193255.1.47886 WP_001193255.1.47898 WP_001193255.1.48019 WP_001193255.1.48100 WP_001193255.1.48114 WP_001193255.1.48139 WP_001193255.1.48190 WP_001193255.1.48292 WP_001193255.1.48426 WP_001193255.1.48430 WP_001193255.1.48586 WP_001193255.1.4859 WP_001193255.1.48591 WP_001193255.1.48610 WP_001193255.1.48631 WP_001193255.1.48663 WP_001193255.1.48690 WP_001193255.1.48734 WP_001193255.1.48756 WP_001193255.1.48778 WP_001193255.1.48849 WP_001193255.1.48955 WP_001193255.1.48963 WP_001193255.1.48973 WP_001193255.1.49004 WP_001193255.1.49106 WP_001193255.1.49117 WP_001193255.1.49121 WP_001193255.1.4914 WP_001193255.1.49140 WP_001193255.1.49153 WP_001193255.1.49166 WP_001193255.1.49355 WP_001193255.1.49429 WP_001193255.1.49434 WP_001193255.1.49450 WP_001193255.1.495 WP_001193255.1.49703 WP_001193255.1.49769 WP_001193255.1.49846 WP_001193255.1.4991 WP_001193255.1.49947 WP_001193255.1.49959 WP_001193255.1.49997 WP_001193255.1.50014 WP_001193255.1.50030 WP_001193255.1.50043 WP_001193255.1.50103 WP_001193255.1.50158 WP_001193255.1.50247 WP_001193255.1.50308 WP_001193255.1.50309 WP_001193255.1.50387 WP_001193255.1.50406 WP_001193255.1.50468 WP_001193255.1.5051 WP_001193255.1.50566 WP_001193255.1.50570 WP_001193255.1.50626 WP_001193255.1.50726 WP_001193255.1.50771 WP_001193255.1.50875 WP_001193255.1.50885 WP_001193255.1.509 WP_001193255.1.50929 WP_001193255.1.50970 WP_001193255.1.51040 WP_001193255.1.51048 WP_001193255.1.51100 WP_001193255.1.51227 WP_001193255.1.5127 WP_001193255.1.51305 WP_001193255.1.51315 WP_001193255.1.5136 WP_001193255.1.51474 WP_001193255.1.51519 WP_001193255.1.51598 WP_001193255.1.51644 WP_001193255.1.51724 WP_001193255.1.51734 WP_001193255.1.51838 WP_001193255.1.51863 WP_001193255.1.51935 WP_001193255.1.52057 WP_001193255.1.52129 WP_001193255.1.52191 WP_001193255.1.52202 WP_001193255.1.52209 WP_001193255.1.52339 WP_001193255.1.52469 WP_001193255.1.52571 WP_001193255.1.526 WP_001193255.1.52647 WP_001193255.1.52742 WP_001193255.1.52773 WP_001193255.1.52795 WP_001193255.1.52807 WP_001193255.1.52887 WP_001193255.1.53092 WP_001193255.1.53141 WP_001193255.1.53151 WP_001193255.1.53159 WP_001193255.1.53210 WP_001193255.1.53233 WP_001193255.1.53307 WP_001193255.1.53321 WP_001193255.1.53368 WP_001193255.1.53375 WP_001193255.1.5349 WP_001193255.1.53540 WP_001193255.1.53555 WP_001193255.1.53559 WP_001193255.1.5356 WP_001193255.1.53571 WP_001193255.1.5358 WP_001193255.1.53723 WP_001193255.1.5374 WP_001193255.1.53750 WP_001193255.1.53800 WP_001193255.1.53815 WP_001193255.1.53839 WP_001193255.1.53892 WP_001193255.1.53898 WP_001193255.1.53958 WP_001193255.1.53981 WP_001193255.1.54132 WP_001193255.1.54170 WP_001193255.1.54175 WP_001193255.1.54203 WP_001193255.1.54259 WP_001193255.1.5430 WP_001193255.1.54371 WP_001193255.1.54431 WP_001193255.1.54442 WP_001193255.1.54482 WP_001193255.1.54589 WP_001193255.1.54667 WP_001193255.1.54678 WP_001193255.1.54681 WP_001193255.1.54748 WP_001193255.1.5481 WP_001193255.1.54865 WP_001193255.1.54935 WP_001193255.1.54979 WP_001193255.1.55010 WP_001193255.1.55034 WP_001193255.1.55163 WP_001193255.1.55165 WP_001193255.1.55215 WP_001193255.1.55310 WP_001193255.1.55317 WP_001193255.1.55379 WP_001193255.1.5539 WP_001193255.1.55468 WP_001193255.1.55506 WP_001193255.1.55604 WP_001193255.1.55639 WP_001193255.1.55699 WP_001193255.1.55725 WP_001193255.1.55967 WP_001193255.1.56144 WP_001193255.1.56172 WP_001193255.1.5621 WP_001193255.1.56226 WP_001193255.1.56311 WP_001193255.1.56419 WP_001193255.1.56423 WP_001193255.1.56514 WP_001193255.1.56535 WP_001193255.1.56585 WP_001193255.1.56640 WP_001193255.1.56724 WP_001193255.1.56825 WP_001193255.1.56887 WP_001193255.1.56889 WP_001193255.1.56981 WP_001193255.1.57101 WP_001193255.1.57137 WP_001193255.1.57147 WP_001193255.1.57179 WP_001193255.1.57186 WP_001193255.1.57342 WP_001193255.1.57684 WP_001193255.1.57699 WP_001193255.1.57785 WP_001193255.1.57800 WP_001193255.1.57873 WP_001193255.1.57965 WP_001193255.1.57972 WP_001193255.1.58008 WP_001193255.1.58044 WP_001193255.1.5809 WP_001193255.1.58132 WP_001193255.1.58173 WP_001193255.1.58191 WP_001193255.1.58194 WP_001193255.1.58252 WP_001193255.1.58261 WP_001193255.1.58274 WP_001193255.1.58282 WP_001193255.1.58324 WP_001193255.1.58326 WP_001193255.1.5836 WP_001193255.1.58485 WP_001193255.1.58537 WP_001193255.1.58568 WP_001193255.1.58583 WP_001193255.1.58652 WP_001193255.1.58663 WP_001193255.1.58724 WP_001193255.1.5875 WP_001193255.1.58796 WP_001193255.1.58807 WP_001193255.1.58847 WP_001193255.1.58883 WP_001193255.1.58898 WP_001193255.1.58949 WP_001193255.1.58963 WP_001193255.1.58970 WP_001193255.1.58974 WP_001193255.1.59043 WP_001193255.1.59056 WP_001193255.1.59061 WP_001193255.1.59064 WP_001193255.1.59299 WP_001193255.1.59313 WP_001193255.1.5949 WP_001193255.1.59501 WP_001193255.1.59510 WP_001193255.1.5969 WP_001193255.1.59751 WP_001193255.1.59827 WP_001193255.1.59829 WP_001193255.1.59863 WP_001193255.1.59969 WP_001193255.1.59994 WP_001193255.1.60045 WP_001193255.1.60076 WP_001193255.1.60114 WP_001193255.1.60154 WP_001193255.1.60168 WP_001193255.1.60192 WP_001193255.1.60199 WP_001193255.1.60212 WP_001193255.1.60253 WP_001193255.1.60322 WP_001193255.1.60324 WP_001193255.1.60356 WP_001193255.1.6038 WP_001193255.1.60380 WP_001193255.1.6041 WP_001193255.1.60424 WP_001193255.1.60481 WP_001193255.1.605 WP_001193255.1.6058 WP_001193255.1.60584 WP_001193255.1.6060 WP_001193255.1.60676 WP_001193255.1.60708 WP_001193255.1.60725 WP_001193255.1.60783 WP_001193255.1.60792 WP_001193255.1.60807 WP_001193255.1.60889 WP_001193255.1.60950 WP_001193255.1.6104 WP_001193255.1.61123 WP_001193255.1.61147 WP_001193255.1.61168 WP_001193255.1.61210 WP_001193255.1.61357 WP_001193255.1.61511 WP_001193255.1.61539 WP_001193255.1.61542 WP_001193255.1.61553 WP_001193255.1.61652 WP_001193255.1.61697 WP_001193255.1.61809 WP_001193255.1.61877 WP_001193255.1.61920 WP_001193255.1.62124 WP_001193255.1.62199 WP_001193255.1.62223 WP_001193255.1.62302 WP_001193255.1.62314 WP_001193255.1.62323 WP_001193255.1.62333 WP_001193255.1.62338 WP_001193255.1.62411 WP_001193255.1.62436 WP_001193255.1.62475 WP_001193255.1.62640 WP_001193255.1.62686 WP_001193255.1.62751 WP_001193255.1.62825 WP_001193255.1.62913 WP_001193255.1.62960 WP_001193255.1.63016 WP_001193255.1.63025 WP_001193255.1.63069 WP_001193255.1.63087 WP_001193255.1.63169 WP_001193255.1.63297 WP_001193255.1.63448 WP_001193255.1.63514 WP_001193255.1.63583 WP_001193255.1.63592 WP_001193255.1.63663 WP_001193255.1.63816 WP_001193255.1.63876 WP_001193255.1.63901 WP_001193255.1.63955 WP_001193255.1.63963 WP_001193255.1.64032 WP_001193255.1.64087 WP_001193255.1.6415 WP_001193255.1.64293 WP_001193255.1.64332 WP_001193255.1.64376 WP_001193255.1.644 WP_001193255.1.64471 WP_001193255.1.64501 WP_001193255.1.64538 WP_001193255.1.64632 WP_001193255.1.64648 WP_001193255.1.64654 WP_001193255.1.64662 WP_001193255.1.64663 WP_001193255.1.64709 WP_001193255.1.64710 WP_001193255.1.64744 WP_001193255.1.64763 WP_001193255.1.64817 WP_001193255.1.64847 WP_001193255.1.6487 WP_001193255.1.64974 WP_001193255.1.65054 WP_001193255.1.65075 WP_001193255.1.6514 WP_001193255.1.65172 WP_001193255.1.65191 WP_001193255.1.65200 WP_001193255.1.65218 WP_001193255.1.65226 WP_001193255.1.65249 WP_001193255.1.65266 WP_001193255.1.65395 WP_001193255.1.65463 WP_001193255.1.65487 WP_001193255.1.6549 WP_001193255.1.65499 WP_001193255.1.6554 WP_001193255.1.65650 WP_001193255.1.65697 WP_001193255.1.65699 WP_001193255.1.65737 WP_001193255.1.65755 WP_001193255.1.65812 WP_001193255.1.65863 WP_001193255.1.65985 WP_001193255.1.66021 WP_001193255.1.66031 WP_001193255.1.66052 WP_001193255.1.66064 WP_001193255.1.66109 WP_001193255.1.66145 WP_001193255.1.66183 WP_001193255.1.6620 WP_001193255.1.66216 WP_001193255.1.66234 WP_001193255.1.66273 WP_001193255.1.66324 WP_001193255.1.6634 WP_001193255.1.66361 WP_001193255.1.66506 WP_001193255.1.66665 WP_001193255.1.66681 WP_001193255.1.66684 WP_001193255.1.66759 WP_001193255.1.66801 WP_001193255.1.66860 WP_001193255.1.66953 WP_001193255.1.66955 WP_001193255.1.66981 WP_001193255.1.67024 WP_001193255.1.67042 WP_001193255.1.67101 WP_001193255.1.67143 WP_001193255.1.67201 WP_001193255.1.67211 WP_001193255.1.67237 WP_001193255.1.67336 WP_001193255.1.67339 WP_001193255.1.67387 WP_001193255.1.67394 WP_001193255.1.67397 WP_001193255.1.67403 WP_001193255.1.67430 WP_001193255.1.67442 WP_001193255.1.67539 WP_001193255.1.67556 WP_001193255.1.67576 WP_001193255.1.67604 WP_001193255.1.67619 WP_001193255.1.67625 WP_001193255.1.67627 WP_001193255.1.67641 WP_001193255.1.67673 WP_001193255.1.67700 WP_001193255.1.67718 WP_001193255.1.67729 WP_001193255.1.67774 WP_001193255.1.67820 WP_001193255.1.67910 WP_001193255.1.67954 WP_001193255.1.68 WP_001193255.1.68043 WP_001193255.1.68105 WP_001193255.1.68113 WP_001193255.1.68131 WP_001193255.1.68182 WP_001193255.1.6819 WP_001193255.1.68285 WP_001193255.1.68359 WP_001193255.1.68420 WP_001193255.1.68514 WP_001193255.1.68564 WP_001193255.1.68688 WP_001193255.1.68742 WP_001193255.1.68770 WP_001193255.1.68809 WP_001193255.1.68914 WP_001193255.1.69053 WP_001193255.1.69170 WP_001193255.1.69210 WP_001193255.1.69270 WP_001193255.1.69282 WP_001193255.1.69376 WP_001193255.1.69396 WP_001193255.1.69466 WP_001193255.1.69611 WP_001193255.1.69642 WP_001193255.1.69656 WP_001193255.1.69657 WP_001193255.1.69690 WP_001193255.1.69923 WP_001193255.1.69948 WP_001193255.1.69953 WP_001193255.1.70010 WP_001193255.1.70049 WP_001193255.1.70058 WP_001193255.1.70061 WP_001193255.1.70205 WP_001193255.1.70240 WP_001193255.1.70249 WP_001193255.1.70314 WP_001193255.1.7033 WP_001193255.1.70427 WP_001193255.1.70433 WP_001193255.1.70545 WP_001193255.1.70623 WP_001193255.1.70671 WP_001193255.1.70708 WP_001193255.1.70717 WP_001193255.1.70731 WP_001193255.1.70772 WP_001193255.1.70845 WP_001193255.1.70846 WP_001193255.1.70981 WP_001193255.1.70995 WP_001193255.1.71039 WP_001193255.1.71057 WP_001193255.1.71081 WP_001193255.1.71117 WP_001193255.1.71455 WP_001193255.1.71456 WP_001193255.1.71487 WP_001193255.1.71523 WP_001193255.1.71542 WP_001193255.1.71566 WP_001193255.1.71640 WP_001193255.1.71651 WP_001193255.1.71653 WP_001193255.1.71716 WP_001193255.1.71872 WP_001193255.1.71950 WP_001193255.1.71954 WP_001193255.1.71985 WP_001193255.1.72003 WP_001193255.1.72073 WP_001193255.1.72269 WP_001193255.1.72350 WP_001193255.1.72383 WP_001193255.1.72461 WP_001193255.1.72527 WP_001193255.1.7255 WP_001193255.1.72631 WP_001193255.1.72667 WP_001193255.1.72674 WP_001193255.1.72724 WP_001193255.1.72789 WP_001193255.1.72828 WP_001193255.1.72896 WP_001193255.1.72969 WP_001193255.1.72987 WP_001193255.1.73052 WP_001193255.1.7311 WP_001193255.1.73114 WP_001193255.1.73177 WP_001193255.1.73180 WP_001193255.1.73258 WP_001193255.1.73285 WP_001193255.1.7332 WP_001193255.1.7333 WP_001193255.1.73352 WP_001193255.1.73389 WP_001193255.1.73425 WP_001193255.1.73488 WP_001193255.1.73504 WP_001193255.1.7353 WP_001193255.1.73544 WP_001193255.1.7361 WP_001193255.1.73648 WP_001193255.1.73768 WP_001193255.1.73849 WP_001193255.1.73948 WP_001193255.1.73999 WP_001193255.1.74024 WP_001193255.1.74030 WP_001193255.1.74038 WP_001193255.1.74043 WP_001193255.1.74058 WP_001193255.1.74070 WP_001193255.1.74077 WP_001193255.1.74135 WP_001193255.1.74214 WP_001193255.1.74241 WP_001193255.1.74285 WP_001193255.1.74317 WP_001193255.1.74415 WP_001193255.1.74616 WP_001193255.1.74621 WP_001193255.1.74647 WP_001193255.1.74677 WP_001193255.1.74699 WP_001193255.1.74831 WP_001193255.1.74894 WP_001193255.1.74939 WP_001193255.1.7507 WP_001193255.1.75089 WP_001193255.1.75116 WP_001193255.1.75237 WP_001193255.1.75273 WP_001193255.1.75296 WP_001193255.1.75413 WP_001193255.1.75433 WP_001193255.1.75532 WP_001193255.1.75565 WP_001193255.1.75593 WP_001193255.1.75610 WP_001193255.1.75633 WP_001193255.1.75718 WP_001193255.1.75745 WP_001193255.1.75844 WP_001193255.1.75886 WP_001193255.1.75898 WP_001193255.1.76081 WP_001193255.1.76116 WP_001193255.1.76122 WP_001193255.1.76256 WP_001193255.1.76339 WP_001193255.1.76366 WP_001193255.1.76417 WP_001193255.1.7646 WP_001193255.1.76510 WP_001193255.1.76558 WP_001193255.1.76572 WP_001193255.1.76651 WP_001193255.1.76653 WP_001193255.1.76788 WP_001193255.1.76854 WP_001193255.1.76916 WP_001193255.1.76932 WP_001193255.1.76973 WP_001193255.1.76988 WP_001193255.1.77016 WP_001193255.1.77087 WP_001193255.1.77090 WP_001193255.1.77111 WP_001193255.1.77384 WP_001193255.1.77501 WP_001193255.1.77512 WP_001193255.1.77513 WP_001193255.1.77563 WP_001193255.1.77702 WP_001193255.1.77713 WP_001193255.1.7772 WP_001193255.1.77825 WP_001193255.1.77837 WP_001193255.1.77900 WP_001193255.1.77975 WP_001193255.1.78035 WP_001193255.1.78048 WP_001193255.1.78107 WP_001193255.1.78166 WP_001193255.1.78192 WP_001193255.1.78195 WP_001193255.1.78291 WP_001193255.1.78309 WP_001193255.1.78320 WP_001193255.1.78382 WP_001193255.1.78388 WP_001193255.1.78410 WP_001193255.1.7862 WP_001193255.1.78626 WP_001193255.1.78661 WP_001193255.1.78674 WP_001193255.1.78676 WP_001193255.1.78761 WP_001193255.1.789 WP_001193255.1.78993 WP_001193255.1.79012 WP_001193255.1.79069 WP_001193255.1.79074 WP_001193255.1.79098 WP_001193255.1.79155 WP_001193255.1.79164 WP_001193255.1.79204 WP_001193255.1.79280 WP_001193255.1.79397 WP_001193255.1.79456 WP_001193255.1.79532 WP_001193255.1.79547 WP_001193255.1.79654 WP_001193255.1.7970 WP_001193255.1.79722 WP_001193255.1.79772 WP_001193255.1.79880 WP_001193255.1.79916 WP_001193255.1.80065 WP_001193255.1.80103 WP_001193255.1.80273 WP_001193255.1.80282 WP_001193255.1.80354 WP_001193255.1.80368 WP_001193255.1.80386 WP_001193255.1.80400 WP_001193255.1.80462 WP_001193255.1.8049 WP_001193255.1.80492 WP_001193255.1.80569 WP_001193255.1.80664 WP_001193255.1.80696 WP_001193255.1.80984 WP_001193255.1.81131 WP_001193255.1.81187 WP_001193255.1.81262 WP_001193255.1.81268 WP_001193255.1.81269 WP_001193255.1.81271 WP_001193255.1.8131 WP_001193255.1.81333 WP_001193255.1.81342 WP_001193255.1.81364 WP_001193255.1.81494 WP_001193255.1.81557 WP_001193255.1.81681 WP_001193255.1.8170 WP_001193255.1.81763 WP_001193255.1.81855 WP_001193255.1.81921 WP_001193255.1.81931 WP_001193255.1.81936 WP_001193255.1.81949 WP_001193255.1.82070 WP_001193255.1.82076 WP_001193255.1.82131 WP_001193255.1.82156 WP_001193255.1.8218 WP_001193255.1.82180 WP_001193255.1.82201 WP_001193255.1.82214 WP_001193255.1.82225 WP_001193255.1.8240 WP_001193255.1.82408 WP_001193255.1.82416 WP_001193255.1.8242 WP_001193255.1.82456 WP_001193255.1.82465 WP_001193255.1.82473 WP_001193255.1.82553 WP_001193255.1.82646 WP_001193255.1.82670 WP_001193255.1.82731 WP_001193255.1.82812 WP_001193255.1.82850 WP_001193255.1.82872 WP_001193255.1.8294 WP_001193255.1.82959 WP_001193255.1.83007 WP_001193255.1.8304 WP_001193255.1.83180 WP_001193255.1.83229 WP_001193255.1.83235 WP_001193255.1.83290 WP_001193255.1.83333 WP_001193255.1.83657 WP_001193255.1.83677 WP_001193255.1.8375 WP_001193255.1.83923 WP_001193255.1.83994 WP_001193255.1.84 WP_001193255.1.8406 WP_001193255.1.84076 WP_001193255.1.84110 WP_001193255.1.84127 WP_001193255.1.84150 WP_001193255.1.84230 WP_001193255.1.84252 WP_001193255.1.8431 WP_001193255.1.84345 WP_001193255.1.84369 WP_001193255.1.84401 WP_001193255.1.84435 WP_001193255.1.84567 WP_001193255.1.84631 WP_001193255.1.84727 WP_001193255.1.84744 WP_001193255.1.84773 WP_001193255.1.84945 WP_001193255.1.84967 WP_001193255.1.85004 WP_001193255.1.8502 WP_001193255.1.85039 WP_001193255.1.85153 WP_001193255.1.85273 WP_001193255.1.85338 WP_001193255.1.85339 WP_001193255.1.85511 WP_001193255.1.85512 WP_001193255.1.8557 WP_001193255.1.85606 WP_001193255.1.85635 WP_001193255.1.85646 WP_001193255.1.85665 WP_001193255.1.85669 WP_001193255.1.85688 WP_001193255.1.85703 WP_001193255.1.85746 WP_001193255.1.85811 WP_001193255.1.859 WP_001193255.1.85917 WP_001193255.1.860 WP_001193255.1.8605 WP_001193255.1.86084 WP_001193255.1.8610 WP_001193255.1.86323 WP_001193255.1.86342 WP_001193255.1.8640 WP_001193255.1.8642 WP_001193255.1.86426 WP_001193255.1.86489 WP_001193255.1.86530 WP_001193255.1.86663 WP_001193255.1.86770 WP_001193255.1.86794 WP_001193255.1.86800 WP_001193255.1.86811 WP_001193255.1.86815 WP_001193255.1.86945 WP_001193255.1.86989 WP_001193255.1.87023 WP_001193255.1.87034 WP_001193255.1.87041 WP_001193255.1.87136 WP_001193255.1.87155 WP_001193255.1.87258 WP_001193255.1.87293 WP_001193255.1.87528 WP_001193255.1.87560 WP_001193255.1.8760 WP_001193255.1.87600 WP_001193255.1.87609 WP_001193255.1.87612 WP_001193255.1.87615 WP_001193255.1.87653 WP_001193255.1.87659 WP_001193255.1.87706 WP_001193255.1.87739 WP_001193255.1.87741 WP_001193255.1.87742 WP_001193255.1.87852 WP_001193255.1.88025 WP_001193255.1.88026 WP_001193255.1.8805 WP_001193255.1.8806 WP_001193255.1.881 WP_001193255.1.88145 WP_001193255.1.88199 WP_001193255.1.88299 WP_001193255.1.88313 WP_001193255.1.88359 WP_001193255.1.88407 WP_001193255.1.88414 WP_001193255.1.88444 WP_001193255.1.88446 WP_001193255.1.88458 WP_001193255.1.88501 WP_001193255.1.88538 WP_001193255.1.88547 WP_001193255.1.88647 WP_001193255.1.88648 WP_001193255.1.88692 WP_001193255.1.88707 WP_001193255.1.88727 WP_001193255.1.88772 WP_001193255.1.88850 WP_001193255.1.8889 WP_001193255.1.88892 WP_001193255.1.88894 WP_001193255.1.89182 WP_001193255.1.89298 WP_001193255.1.89308 WP_001193255.1.89314 WP_001193255.1.89328 WP_001193255.1.89332 WP_001193255.1.89395 WP_001193255.1.8940 WP_001193255.1.8947 WP_001193255.1.89503 WP_001193255.1.89591 WP_001193255.1.89612 WP_001193255.1.89668 WP_001193255.1.89706 WP_001193255.1.89713 WP_001193255.1.89733 WP_001193255.1.89796 WP_001193255.1.89804 WP_001193255.1.89845 WP_001193255.1.89888 WP_001193255.1.89911 WP_001193255.1.8995 WP_001193255.1.89952 WP_001193255.1.90007 WP_001193255.1.9011 WP_001193255.1.90240 WP_001193255.1.90274 WP_001193255.1.90280 WP_001193255.1.90330 WP_001193255.1.90365 WP_001193255.1.90428 WP_001193255.1.90489 WP_001193255.1.90513 WP_001193255.1.90582 WP_001193255.1.90713 WP_001193255.1.90794 WP_001193255.1.90796 WP_001193255.1.90811 WP_001193255.1.9091 WP_001193255.1.91067 WP_001193255.1.91164 WP_001193255.1.91205 WP_001193255.1.91239 WP_001193255.1.91313 WP_001193255.1.9135 WP_001193255.1.91506 WP_001193255.1.91557 WP_001193255.1.91597 WP_001193255.1.91715 WP_001193255.1.9187 WP_001193255.1.91870 WP_001193255.1.92087 WP_001193255.1.92098 WP_001193255.1.92156 WP_001193255.1.92172 WP_001193255.1.92243 WP_001193255.1.92327 WP_001193255.1.92470 WP_001193255.1.92477 WP_001193255.1.92545 WP_001193255.1.92588 WP_001193255.1.926 WP_001193255.1.92633 WP_001193255.1.92649 WP_001193255.1.92676 WP_001193255.1.92705 WP_001193255.1.9271 WP_001193255.1.92734 WP_001193255.1.92810 WP_001193255.1.92823 WP_001193255.1.92987 WP_001193255.1.93007 WP_001193255.1.93022 WP_001193255.1.93103 WP_001193255.1.93105 WP_001193255.1.93111 WP_001193255.1.93121 WP_001193255.1.93184 WP_001193255.1.93221 WP_001193255.1.93223 WP_001193255.1.93239 WP_001193255.1.93302 WP_001193255.1.9336 WP_001193255.1.93387 WP_001193255.1.93469 WP_001193255.1.93511 WP_001193255.1.93512 WP_001193255.1.93635 WP_001193255.1.93657 WP_001193255.1.9374 WP_001193255.1.9375 WP_001193255.1.93754 WP_001193255.1.93780 WP_001193255.1.93828 WP_001193255.1.93842 WP_001193255.1.93843 WP_001193255.1.93875 WP_001193255.1.93909 WP_001193255.1.93919 WP_001193255.1.93938 WP_001193255.1.93984 WP_001193255.1.9399 WP_001193255.1.94017 WP_001193255.1.94079 WP_001193255.1.94097 WP_001193255.1.94107 WP_001193255.1.94142 WP_001193255.1.94215 WP_001193255.1.94303 WP_001193255.1.94365 WP_001193255.1.94390 WP_001193255.1.94415 WP_001193255.1.94492 WP_001193255.1.94527 WP_001193255.1.94573 WP_001193255.1.94579 WP_001193255.1.94586 WP_001193255.1.94593 WP_001193255.1.94650 WP_001193255.1.94659 WP_001193255.1.94662 WP_001193255.1.94700 WP_001193255.1.94745 WP_001193255.1.94782 WP_001193255.1.94815 WP_001193255.1.94820 WP_001193255.1.94851 WP_001193255.1.94864 WP_001193255.1.94952 WP_001193255.1.95006 WP_001193255.1.95055 WP_001193255.1.95076 WP_001193255.1.95165 WP_001193255.1.95239 WP_001193255.1.95246 WP_001193255.1.9525 WP_001193255.1.95255 WP_001193255.1.95265 WP_001193255.1.95338 WP_001193255.1.95412 WP_001193255.1.95530 WP_001193255.1.95590 WP_001193255.1.95625 WP_001193255.1.95675 WP_001193255.1.95716 WP_001193255.1.95776 WP_001193255.1.95884 WP_001193255.1.95890 WP_001193255.1.95906 WP_001193255.1.96025 WP_001193255.1.96044 WP_001193255.1.96054 WP_001193255.1.96094 WP_001193255.1.96144 WP_001193255.1.96188 WP_001193255.1.96211 WP_001193255.1.96319 WP_001193255.1.9633 WP_001193255.1.96359 WP_001193255.1.96539 WP_001193255.1.96552 WP_001193255.1.96610 WP_001193255.1.96625 WP_001193255.1.96635 WP_001193255.1.96675 WP_001193255.1.9670 WP_001193255.1.96750 WP_001193255.1.96792 WP_001193255.1.96801 WP_001193255.1.96803 WP_001193255.1.96925 WP_001193255.1.96938 WP_001193255.1.96946 WP_001193255.1.96957 WP_001193255.1.96978 WP_001193255.1.97026 WP_001193255.1.97028 WP_001193255.1.97079 WP_001193255.1.97154 WP_001193255.1.97184 WP_001193255.1.97287 WP_001193255.1.97291 WP_001193255.1.97422 WP_001193255.1.97441 WP_001193255.1.97497 WP_001193255.1.97505 WP_001193255.1.97599 WP_001193255.1.97606 WP_001193255.1.97615 WP_001193255.1.97646 WP_001193255.1.97690 WP_001193255.1.97819 WP_001193255.1.97840 WP_001193255.1.97938 WP_001193255.1.97986 WP_001193255.1.98036 WP_001193255.1.98080 WP_001193255.1.98086 WP_001193255.1.98158 WP_001193255.1.98263 WP_001193255.1.98418 WP_001193255.1.98448 WP_001193255.1.98457 WP_001193255.1.9850 WP_001193255.1.98502 WP_001193255.1.98607 WP_001193255.1.98731 WP_001193255.1.98762 WP_001193255.1.9877 WP_001193255.1.98801 WP_001193255.1.98818 WP_001193255.1.99163 WP_001193255.1.99335 WP_001193255.1.99350 WP_001193255.1.99360 WP_001193255.1.99363 WP_001193255.1.99369 WP_001193255.1.99388 WP_001193255.1.99463 WP_001193255.1.99483 WP_001193255.1.99546 WP_001193255.1.99579 WP_001193255.1.99595 WP_001193255.1.99671 WP_001193255.1.99764 WP_001193255.1.99829 WP_001193255.1.99837 WP_001193255.1.99841 WP_001193255.1.9992 WP_001193255.1.99996 AE014613|CDS_1609641-1613165 AL513382|CDS_1371541-1368017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]