SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 220341.STY2521 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  220341.STY2521
Domain Number 1 Region: 149-403
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 3.8e-56
Family D-glucarate dehydratase-like 0.002
Further Details:      
 
Domain Number 2 Region: 45-162
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 2.46e-23
Family Enolase N-terminal domain-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 220341.STY2521
Sequence length 405
Comment (Salmonella typhi)
Sequence
MENIMTLPKIKHVRAWFIGGATAEKGAGGGDYHDQGGNHWIDDHIATPMSKYRDYEQSRQ
SFGINVLGTLIVEVEAENGQTGFAVSTAGEMGCFIVEKHLNRFIEGKCVSDIKLIHDQML
GATMYYSGSGGLVMNTISCVDLALWDLFGKVVGLPVYKLLGGAVRDEIQFYATGARPDLA
KEMGFIGGKMPTHWGPHDGDAGIRKDAAMVADMREKCGPDFWLMLDCWMSQDVNYATKLA
HACAPFNLKWIEECLPPQQYEGYRELKRNAPAGMMVTSGEHHGTLQSFRTLAETGIDIMQ
PDVGWCGGLTTLVEIAALAKSRGQLVVPHGSSVYSHHAVITFTNTPFSEFLMTSPDCSTL
RPQFDPILLDEPVPVNGRIHKSVLDKPGFGVELNRDCHLKRPYSH
Download sequence
Identical sequences A0A0G2NQS7 A0A1X2UMH8 A0A1Z3X3T6 A0A267SD88 A0A2I6M644 A0A2I6NBK8 A9N5C2 B5R264 B5RCB6 M7REP4 Q57M62 Q8Z548 S4HVR9 V1WRI1
gi|205353407|ref|YP_002227208.1| gi|549479935|ref|YP_008614061.1| AE014613|CDS_647684-648901 AL513382|CDS_2357028-2355811 AM933172|CDS_2393473-2392256 AM933173|CDS_2384341-2383124 gi|528820109|ref|YP_008361312.1| gi|207857709|ref|YP_002244360.1| 209261.t0572 220341.STY2521 550537.SEN2273 550538.SG2319 gi|16761217|ref|NP_456834.1| gi|563653750|ref|YP_008861825.1| gi|525946734|ref|YP_008307956.1| gi|529219209|ref|YP_008380104.1| NP_456834.1.84458 WP_000427822.1.100002 WP_000427822.1.100007 WP_000427822.1.100008 WP_000427822.1.100017 WP_000427822.1.100031 WP_000427822.1.100036 WP_000427822.1.100077 WP_000427822.1.100079 WP_000427822.1.100115 WP_000427822.1.100129 WP_000427822.1.10013 WP_000427822.1.100196 WP_000427822.1.1002 WP_000427822.1.100266 WP_000427822.1.100284 WP_000427822.1.100288 WP_000427822.1.100313 WP_000427822.1.100314 WP_000427822.1.100321 WP_000427822.1.100354 WP_000427822.1.100392 WP_000427822.1.100412 WP_000427822.1.100421 WP_000427822.1.100438 WP_000427822.1.100446 WP_000427822.1.100450 WP_000427822.1.100457 WP_000427822.1.100472 WP_000427822.1.100502 WP_000427822.1.100541 WP_000427822.1.100557 WP_000427822.1.100584 WP_000427822.1.100592 WP_000427822.1.100610 WP_000427822.1.100642 WP_000427822.1.10065 WP_000427822.1.100650 WP_000427822.1.100711 WP_000427822.1.100721 WP_000427822.1.100732 WP_000427822.1.100733 WP_000427822.1.100739 WP_000427822.1.100750 WP_000427822.1.100764 WP_000427822.1.100776 WP_000427822.1.100790 WP_000427822.1.100799 WP_000427822.1.10081 WP_000427822.1.100814 WP_000427822.1.100857 WP_000427822.1.100865 WP_000427822.1.100870 WP_000427822.1.100886 WP_000427822.1.100932 WP_000427822.1.100941 WP_000427822.1.100953 WP_000427822.1.101011 WP_000427822.1.10108 WP_000427822.1.101094 WP_000427822.1.101112 WP_000427822.1.101123 WP_000427822.1.101147 WP_000427822.1.101226 WP_000427822.1.10124 WP_000427822.1.101271 WP_000427822.1.101312 WP_000427822.1.101322 WP_000427822.1.101374 WP_000427822.1.101473 WP_000427822.1.101541 WP_000427822.1.101609 WP_000427822.1.101612 WP_000427822.1.101616 WP_000427822.1.101634 WP_000427822.1.101639 WP_000427822.1.10164 WP_000427822.1.101724 WP_000427822.1.101741 WP_000427822.1.101759 WP_000427822.1.10177 WP_000427822.1.101815 WP_000427822.1.101841 WP_000427822.1.101890 WP_000427822.1.10191 WP_000427822.1.101917 WP_000427822.1.101927 WP_000427822.1.101941 WP_000427822.1.102009 WP_000427822.1.102050 WP_000427822.1.102087 WP_000427822.1.102111 WP_000427822.1.10237 WP_000427822.1.10276 WP_000427822.1.10300 WP_000427822.1.1038 WP_000427822.1.10394 WP_000427822.1.104 WP_000427822.1.10401 WP_000427822.1.10428 WP_000427822.1.10459 WP_000427822.1.10475 WP_000427822.1.10498 WP_000427822.1.10507 WP_000427822.1.10511 WP_000427822.1.10514 WP_000427822.1.10521 WP_000427822.1.10530 WP_000427822.1.10532 WP_000427822.1.10547 WP_000427822.1.10562 WP_000427822.1.10595 WP_000427822.1.10642 WP_000427822.1.10654 WP_000427822.1.10675 WP_000427822.1.10677 WP_000427822.1.10720 WP_000427822.1.10755 WP_000427822.1.10797 WP_000427822.1.10857 WP_000427822.1.10873 WP_000427822.1.10926 WP_000427822.1.10936 WP_000427822.1.11012 WP_000427822.1.11041 WP_000427822.1.11055 WP_000427822.1.11119 WP_000427822.1.11126 WP_000427822.1.11142 WP_000427822.1.11213 WP_000427822.1.11216 WP_000427822.1.11239 WP_000427822.1.11254 WP_000427822.1.113 WP_000427822.1.11304 WP_000427822.1.11314 WP_000427822.1.1135 WP_000427822.1.11369 WP_000427822.1.1137 WP_000427822.1.1142 WP_000427822.1.11426 WP_000427822.1.11429 WP_000427822.1.1150 WP_000427822.1.11511 WP_000427822.1.11528 WP_000427822.1.1156 WP_000427822.1.11565 WP_000427822.1.11567 WP_000427822.1.11621 WP_000427822.1.11638 WP_000427822.1.1174 WP_000427822.1.11824 WP_000427822.1.11875 WP_000427822.1.11883 WP_000427822.1.11900 WP_000427822.1.11908 WP_000427822.1.11914 WP_000427822.1.11936 WP_000427822.1.11978 WP_000427822.1.12007 WP_000427822.1.12027 WP_000427822.1.12040 WP_000427822.1.12047 WP_000427822.1.12059 WP_000427822.1.12061 WP_000427822.1.12063 WP_000427822.1.1207 WP_000427822.1.12141 WP_000427822.1.1215 WP_000427822.1.12168 WP_000427822.1.12172 WP_000427822.1.12192 WP_000427822.1.1224 WP_000427822.1.12244 WP_000427822.1.12364 WP_000427822.1.1239 WP_000427822.1.12396 WP_000427822.1.12397 WP_000427822.1.12398 WP_000427822.1.12441 WP_000427822.1.12456 WP_000427822.1.12484 WP_000427822.1.1250 WP_000427822.1.12568 WP_000427822.1.12581 WP_000427822.1.12584 WP_000427822.1.12620 WP_000427822.1.12648 WP_000427822.1.12650 WP_000427822.1.12683 WP_000427822.1.12696 WP_000427822.1.12726 WP_000427822.1.12727 WP_000427822.1.12741 WP_000427822.1.12834 WP_000427822.1.12864 WP_000427822.1.1299 WP_000427822.1.13102 WP_000427822.1.13108 WP_000427822.1.13161 WP_000427822.1.1321 WP_000427822.1.13247 WP_000427822.1.1326 WP_000427822.1.13268 WP_000427822.1.13274 WP_000427822.1.13291 WP_000427822.1.133 WP_000427822.1.13314 WP_000427822.1.13342 WP_000427822.1.13352 WP_000427822.1.13406 WP_000427822.1.13440 WP_000427822.1.13443 WP_000427822.1.13446 WP_000427822.1.1346 WP_000427822.1.13476 WP_000427822.1.13543 WP_000427822.1.13599 WP_000427822.1.13625 WP_000427822.1.13686 WP_000427822.1.13691 WP_000427822.1.1372 WP_000427822.1.13732 WP_000427822.1.13750 WP_000427822.1.13799 WP_000427822.1.1382 WP_000427822.1.13827 WP_000427822.1.13829 WP_000427822.1.13848 WP_000427822.1.1397 WP_000427822.1.13972 WP_000427822.1.140 WP_000427822.1.1401 WP_000427822.1.14089 WP_000427822.1.14099 WP_000427822.1.1412 WP_000427822.1.14120 WP_000427822.1.14123 WP_000427822.1.14150 WP_000427822.1.14191 WP_000427822.1.14197 WP_000427822.1.14212 WP_000427822.1.14280 WP_000427822.1.14286 WP_000427822.1.14296 WP_000427822.1.14333 WP_000427822.1.14399 WP_000427822.1.14444 WP_000427822.1.14446 WP_000427822.1.14467 WP_000427822.1.14474 WP_000427822.1.14500 WP_000427822.1.14516 WP_000427822.1.14526 WP_000427822.1.14528 WP_000427822.1.14550 WP_000427822.1.14575 WP_000427822.1.14701 WP_000427822.1.14703 WP_000427822.1.14708 WP_000427822.1.14719 WP_000427822.1.1473 WP_000427822.1.14765 WP_000427822.1.14789 WP_000427822.1.14793 WP_000427822.1.14808 WP_000427822.1.14810 WP_000427822.1.14819 WP_000427822.1.14877 WP_000427822.1.14884 WP_000427822.1.14894 WP_000427822.1.14917 WP_000427822.1.14930 WP_000427822.1.14936 WP_000427822.1.14947 WP_000427822.1.14948 WP_000427822.1.15046 WP_000427822.1.15054 WP_000427822.1.15059 WP_000427822.1.15100 WP_000427822.1.15102 WP_000427822.1.15184 WP_000427822.1.15214 WP_000427822.1.15244 WP_000427822.1.15265 WP_000427822.1.15276 WP_000427822.1.15353 WP_000427822.1.15362 WP_000427822.1.15415 WP_000427822.1.15423 WP_000427822.1.15433 WP_000427822.1.15468 WP_000427822.1.15479 WP_000427822.1.15483 WP_000427822.1.15487 WP_000427822.1.1551 WP_000427822.1.15535 WP_000427822.1.15581 WP_000427822.1.15586 WP_000427822.1.15597 WP_000427822.1.15612 WP_000427822.1.15616 WP_000427822.1.15625 WP_000427822.1.15708 WP_000427822.1.15710 WP_000427822.1.15775 WP_000427822.1.158 WP_000427822.1.15905 WP_000427822.1.15909 WP_000427822.1.15912 WP_000427822.1.1592 WP_000427822.1.15978 WP_000427822.1.15995 WP_000427822.1.16006 WP_000427822.1.1601 WP_000427822.1.16028 WP_000427822.1.16046 WP_000427822.1.16051 WP_000427822.1.16052 WP_000427822.1.16058 WP_000427822.1.16125 WP_000427822.1.16150 WP_000427822.1.16155 WP_000427822.1.16158 WP_000427822.1.16172 WP_000427822.1.16201 WP_000427822.1.16244 WP_000427822.1.1626 WP_000427822.1.16264 WP_000427822.1.16273 WP_000427822.1.16331 WP_000427822.1.16344 WP_000427822.1.16363 WP_000427822.1.16394 WP_000427822.1.16452 WP_000427822.1.16461 WP_000427822.1.16462 WP_000427822.1.16465 WP_000427822.1.16474 WP_000427822.1.16522 WP_000427822.1.16581 WP_000427822.1.16588 WP_000427822.1.16656 WP_000427822.1.16658 WP_000427822.1.16666 WP_000427822.1.16673 WP_000427822.1.1668 WP_000427822.1.16729 WP_000427822.1.1674 WP_000427822.1.16767 WP_000427822.1.16781 WP_000427822.1.16804 WP_000427822.1.16819 WP_000427822.1.16826 WP_000427822.1.16855 WP_000427822.1.16879 WP_000427822.1.1689 WP_000427822.1.16893 WP_000427822.1.16905 WP_000427822.1.16910 WP_000427822.1.16941 WP_000427822.1.16942 WP_000427822.1.16944 WP_000427822.1.16948 WP_000427822.1.16949 WP_000427822.1.16998 WP_000427822.1.17031 WP_000427822.1.17049 WP_000427822.1.17058 WP_000427822.1.17060 WP_000427822.1.17078 WP_000427822.1.17096 WP_000427822.1.17098 WP_000427822.1.17188 WP_000427822.1.17202 WP_000427822.1.17219 WP_000427822.1.1722 WP_000427822.1.17270 WP_000427822.1.17285 WP_000427822.1.17308 WP_000427822.1.17368 WP_000427822.1.17390 WP_000427822.1.17405 WP_000427822.1.17406 WP_000427822.1.17447 WP_000427822.1.17513 WP_000427822.1.17525 WP_000427822.1.17543 WP_000427822.1.17563 WP_000427822.1.17578 WP_000427822.1.17583 WP_000427822.1.17622 WP_000427822.1.17659 WP_000427822.1.17667 WP_000427822.1.17686 WP_000427822.1.17693 WP_000427822.1.17703 WP_000427822.1.17732 WP_000427822.1.17741 WP_000427822.1.17755 WP_000427822.1.17758 WP_000427822.1.17840 WP_000427822.1.17865 WP_000427822.1.17886 WP_000427822.1.17936 WP_000427822.1.17949 WP_000427822.1.17956 WP_000427822.1.17991 WP_000427822.1.18005 WP_000427822.1.1801 WP_000427822.1.18021 WP_000427822.1.18056 WP_000427822.1.18061 WP_000427822.1.18089 WP_000427822.1.18092 WP_000427822.1.18099 WP_000427822.1.18124 WP_000427822.1.18144 WP_000427822.1.18173 WP_000427822.1.18192 WP_000427822.1.18270 WP_000427822.1.18277 WP_000427822.1.18280 WP_000427822.1.18281 WP_000427822.1.18328 WP_000427822.1.18358 WP_000427822.1.18365 WP_000427822.1.18370 WP_000427822.1.18384 WP_000427822.1.18406 WP_000427822.1.18426 WP_000427822.1.18445 WP_000427822.1.18474 WP_000427822.1.18485 WP_000427822.1.18513 WP_000427822.1.18610 WP_000427822.1.18641 WP_000427822.1.18678 WP_000427822.1.18686 WP_000427822.1.18692 WP_000427822.1.18722 WP_000427822.1.18737 WP_000427822.1.18766 WP_000427822.1.1880 WP_000427822.1.18847 WP_000427822.1.1885 WP_000427822.1.18860 WP_000427822.1.18886 WP_000427822.1.18919 WP_000427822.1.18922 WP_000427822.1.1895 WP_000427822.1.18959 WP_000427822.1.1897 WP_000427822.1.19001 WP_000427822.1.19006 WP_000427822.1.19030 WP_000427822.1.19038 WP_000427822.1.19044 WP_000427822.1.19084 WP_000427822.1.19163 WP_000427822.1.19174 WP_000427822.1.19187 WP_000427822.1.19228 WP_000427822.1.19240 WP_000427822.1.19288 WP_000427822.1.19300 WP_000427822.1.19357 WP_000427822.1.1939 WP_000427822.1.19405 WP_000427822.1.19422 WP_000427822.1.19454 WP_000427822.1.19456 WP_000427822.1.19469 WP_000427822.1.19496 WP_000427822.1.19535 WP_000427822.1.19538 WP_000427822.1.1955 WP_000427822.1.19589 WP_000427822.1.19660 WP_000427822.1.19663 WP_000427822.1.19683 WP_000427822.1.19686 WP_000427822.1.19731 WP_000427822.1.19794 WP_000427822.1.19851 WP_000427822.1.19863 WP_000427822.1.1990 WP_000427822.1.1992 WP_000427822.1.19938 WP_000427822.1.19970 WP_000427822.1.19999 WP_000427822.1.20023 WP_000427822.1.20081 WP_000427822.1.20091 WP_000427822.1.20218 WP_000427822.1.20254 WP_000427822.1.20255 WP_000427822.1.20296 WP_000427822.1.20339 WP_000427822.1.2036 WP_000427822.1.20376 WP_000427822.1.20391 WP_000427822.1.2041 WP_000427822.1.20419 WP_000427822.1.20425 WP_000427822.1.20465 WP_000427822.1.2047 WP_000427822.1.20492 WP_000427822.1.2053 WP_000427822.1.20635 WP_000427822.1.20695 WP_000427822.1.20718 WP_000427822.1.20721 WP_000427822.1.2073 WP_000427822.1.20740 WP_000427822.1.20767 WP_000427822.1.20789 WP_000427822.1.20795 WP_000427822.1.20810 WP_000427822.1.20828 WP_000427822.1.20839 WP_000427822.1.2087 WP_000427822.1.20883 WP_000427822.1.2091 WP_000427822.1.20947 WP_000427822.1.20953 WP_000427822.1.21010 WP_000427822.1.2106 WP_000427822.1.21062 WP_000427822.1.2107 WP_000427822.1.21075 WP_000427822.1.21079 WP_000427822.1.21089 WP_000427822.1.21103 WP_000427822.1.21144 WP_000427822.1.2116 WP_000427822.1.21162 WP_000427822.1.21181 WP_000427822.1.21184 WP_000427822.1.21185 WP_000427822.1.21332 WP_000427822.1.21366 WP_000427822.1.21404 WP_000427822.1.21423 WP_000427822.1.21473 WP_000427822.1.21492 WP_000427822.1.21616 WP_000427822.1.2166 WP_000427822.1.21674 WP_000427822.1.21681 WP_000427822.1.21692 WP_000427822.1.21728 WP_000427822.1.21792 WP_000427822.1.21825 WP_000427822.1.21845 WP_000427822.1.21909 WP_000427822.1.21940 WP_000427822.1.21946 WP_000427822.1.21950 WP_000427822.1.21966 WP_000427822.1.21981 WP_000427822.1.22019 WP_000427822.1.22030 WP_000427822.1.22051 WP_000427822.1.22064 WP_000427822.1.22096 WP_000427822.1.22117 WP_000427822.1.22118 WP_000427822.1.22126 WP_000427822.1.22136 WP_000427822.1.22158 WP_000427822.1.2216 WP_000427822.1.22208 WP_000427822.1.2224 WP_000427822.1.22240 WP_000427822.1.2227 WP_000427822.1.22270 WP_000427822.1.22296 WP_000427822.1.22323 WP_000427822.1.22337 WP_000427822.1.22346 WP_000427822.1.22373 WP_000427822.1.22449 WP_000427822.1.22460 WP_000427822.1.22476 WP_000427822.1.22514 WP_000427822.1.22582 WP_000427822.1.22590 WP_000427822.1.22595 WP_000427822.1.22614 WP_000427822.1.22623 WP_000427822.1.22652 WP_000427822.1.22676 WP_000427822.1.22683 WP_000427822.1.22760 WP_000427822.1.2284 WP_000427822.1.22845 WP_000427822.1.22855 WP_000427822.1.22857 WP_000427822.1.22895 WP_000427822.1.22926 WP_000427822.1.22943 WP_000427822.1.22947 WP_000427822.1.22967 WP_000427822.1.23040 WP_000427822.1.23053 WP_000427822.1.23058 WP_000427822.1.23080 WP_000427822.1.23148 WP_000427822.1.23155 WP_000427822.1.23218 WP_000427822.1.2324 WP_000427822.1.23258 WP_000427822.1.23274 WP_000427822.1.23279 WP_000427822.1.23309 WP_000427822.1.2332 WP_000427822.1.23329 WP_000427822.1.23340 WP_000427822.1.2336 WP_000427822.1.23365 WP_000427822.1.23412 WP_000427822.1.23426 WP_000427822.1.23442 WP_000427822.1.23466 WP_000427822.1.23492 WP_000427822.1.23503 WP_000427822.1.23513 WP_000427822.1.23515 WP_000427822.1.23529 WP_000427822.1.23548 WP_000427822.1.2358 WP_000427822.1.23604 WP_000427822.1.23631 WP_000427822.1.23639 WP_000427822.1.23643 WP_000427822.1.23670 WP_000427822.1.23679 WP_000427822.1.23685 WP_000427822.1.23728 WP_000427822.1.23736 WP_000427822.1.23746 WP_000427822.1.2375 WP_000427822.1.2376 WP_000427822.1.23783 WP_000427822.1.23786 WP_000427822.1.23787 WP_000427822.1.23801 WP_000427822.1.24028 WP_000427822.1.24061 WP_000427822.1.24083 WP_000427822.1.24117 WP_000427822.1.24125 WP_000427822.1.24138 WP_000427822.1.24145 WP_000427822.1.24153 WP_000427822.1.24163 WP_000427822.1.24291 WP_000427822.1.24297 WP_000427822.1.24322 WP_000427822.1.24325 WP_000427822.1.24355 WP_000427822.1.24375 WP_000427822.1.24376 WP_000427822.1.24392 WP_000427822.1.24400 WP_000427822.1.24408 WP_000427822.1.24412 WP_000427822.1.24420 WP_000427822.1.24433 WP_000427822.1.24444 WP_000427822.1.24476 WP_000427822.1.24494 WP_000427822.1.24521 WP_000427822.1.24555 WP_000427822.1.24619 WP_000427822.1.24643 WP_000427822.1.24688 WP_000427822.1.24696 WP_000427822.1.24716 WP_000427822.1.24723 WP_000427822.1.24803 WP_000427822.1.2481 WP_000427822.1.24837 WP_000427822.1.24901 WP_000427822.1.24964 WP_000427822.1.25017 WP_000427822.1.25032 WP_000427822.1.25041 WP_000427822.1.25053 WP_000427822.1.25072 WP_000427822.1.25130 WP_000427822.1.25159 WP_000427822.1.25185 WP_000427822.1.25196 WP_000427822.1.25205 WP_000427822.1.25210 WP_000427822.1.25217 WP_000427822.1.25219 WP_000427822.1.2525 WP_000427822.1.25304 WP_000427822.1.25354 WP_000427822.1.25374 WP_000427822.1.25421 WP_000427822.1.25475 WP_000427822.1.25490 WP_000427822.1.25498 WP_000427822.1.25508 WP_000427822.1.25512 WP_000427822.1.25514 WP_000427822.1.25546 WP_000427822.1.25564 WP_000427822.1.25596 WP_000427822.1.25603 WP_000427822.1.2562 WP_000427822.1.25666 WP_000427822.1.2568 WP_000427822.1.25700 WP_000427822.1.25709 WP_000427822.1.25722 WP_000427822.1.25780 WP_000427822.1.25807 WP_000427822.1.25809 WP_000427822.1.25821 WP_000427822.1.25833 WP_000427822.1.25835 WP_000427822.1.25882 WP_000427822.1.25911 WP_000427822.1.25951 WP_000427822.1.25962 WP_000427822.1.26001 WP_000427822.1.26027 WP_000427822.1.26030 WP_000427822.1.26075 WP_000427822.1.26083 WP_000427822.1.26107 WP_000427822.1.26123 WP_000427822.1.2615 WP_000427822.1.26194 WP_000427822.1.26217 WP_000427822.1.26230 WP_000427822.1.26232 WP_000427822.1.26269 WP_000427822.1.26272 WP_000427822.1.26286 WP_000427822.1.26288 WP_000427822.1.2634 WP_000427822.1.26363 WP_000427822.1.26384 WP_000427822.1.26394 WP_000427822.1.26426 WP_000427822.1.26491 WP_000427822.1.26512 WP_000427822.1.26532 WP_000427822.1.2654 WP_000427822.1.26554 WP_000427822.1.26582 WP_000427822.1.26587 WP_000427822.1.2660 WP_000427822.1.26636 WP_000427822.1.26687 WP_000427822.1.26689 WP_000427822.1.2672 WP_000427822.1.2679 WP_000427822.1.26794 WP_000427822.1.26833 WP_000427822.1.26883 WP_000427822.1.26908 WP_000427822.1.2692 WP_000427822.1.26928 WP_000427822.1.26936 WP_000427822.1.26980 WP_000427822.1.270 WP_000427822.1.27008 WP_000427822.1.27027 WP_000427822.1.27051 WP_000427822.1.27070 WP_000427822.1.27077 WP_000427822.1.27086 WP_000427822.1.27087 WP_000427822.1.27111 WP_000427822.1.27115 WP_000427822.1.2713 WP_000427822.1.27169 WP_000427822.1.2717 WP_000427822.1.272 WP_000427822.1.27228 WP_000427822.1.2723 WP_000427822.1.27255 WP_000427822.1.27272 WP_000427822.1.27282 WP_000427822.1.27285 WP_000427822.1.27309 WP_000427822.1.27314 WP_000427822.1.27329 WP_000427822.1.27342 WP_000427822.1.27361 WP_000427822.1.27383 WP_000427822.1.27419 WP_000427822.1.27513 WP_000427822.1.27522 WP_000427822.1.27523 WP_000427822.1.27547 WP_000427822.1.27556 WP_000427822.1.27565 WP_000427822.1.27595 WP_000427822.1.27616 WP_000427822.1.27632 WP_000427822.1.27638 WP_000427822.1.27655 WP_000427822.1.27658 WP_000427822.1.27706 WP_000427822.1.27755 WP_000427822.1.27775 WP_000427822.1.27776 WP_000427822.1.27785 WP_000427822.1.27798 WP_000427822.1.27800 WP_000427822.1.27883 WP_000427822.1.27900 WP_000427822.1.27928 WP_000427822.1.27945 WP_000427822.1.27969 WP_000427822.1.27995 WP_000427822.1.28002 WP_000427822.1.28004 WP_000427822.1.28037 WP_000427822.1.28056 WP_000427822.1.2806 WP_000427822.1.2809 WP_000427822.1.28155 WP_000427822.1.28174 WP_000427822.1.28198 WP_000427822.1.28200 WP_000427822.1.2822 WP_000427822.1.28229 WP_000427822.1.28232 WP_000427822.1.28233 WP_000427822.1.28235 WP_000427822.1.2825 WP_000427822.1.28267 WP_000427822.1.28301 WP_000427822.1.28303 WP_000427822.1.28384 WP_000427822.1.28386 WP_000427822.1.28393 WP_000427822.1.28395 WP_000427822.1.284 WP_000427822.1.2845 WP_000427822.1.28479 WP_000427822.1.2853 WP_000427822.1.28570 WP_000427822.1.28612 WP_000427822.1.28620 WP_000427822.1.28627 WP_000427822.1.28692 WP_000427822.1.2873 WP_000427822.1.28773 WP_000427822.1.28775 WP_000427822.1.28776 WP_000427822.1.28811 WP_000427822.1.28917 WP_000427822.1.28962 WP_000427822.1.28963 WP_000427822.1.28977 WP_000427822.1.29042 WP_000427822.1.2905 WP_000427822.1.2907 WP_000427822.1.29081 WP_000427822.1.29089 WP_000427822.1.29130 WP_000427822.1.29153 WP_000427822.1.29168 WP_000427822.1.29203 WP_000427822.1.29218 WP_000427822.1.29237 WP_000427822.1.2924 WP_000427822.1.29248 WP_000427822.1.29274 WP_000427822.1.29288 WP_000427822.1.29379 WP_000427822.1.29389 WP_000427822.1.29422 WP_000427822.1.29436 WP_000427822.1.29454 WP_000427822.1.2946 WP_000427822.1.29462 WP_000427822.1.29563 WP_000427822.1.29576 WP_000427822.1.29711 WP_000427822.1.29727 WP_000427822.1.29732 WP_000427822.1.29743 WP_000427822.1.29775 WP_000427822.1.29782 WP_000427822.1.29851 WP_000427822.1.29865 WP_000427822.1.29886 WP_000427822.1.29919 WP_000427822.1.29923 WP_000427822.1.29924 WP_000427822.1.2994 WP_000427822.1.29964 WP_000427822.1.29983 WP_000427822.1.30009 WP_000427822.1.30013 WP_000427822.1.30018 WP_000427822.1.30034 WP_000427822.1.30049 WP_000427822.1.3005 WP_000427822.1.30058 WP_000427822.1.30172 WP_000427822.1.30185 WP_000427822.1.30210 WP_000427822.1.30225 WP_000427822.1.30238 WP_000427822.1.30278 WP_000427822.1.30331 WP_000427822.1.30354 WP_000427822.1.30356 WP_000427822.1.30357 WP_000427822.1.30362 WP_000427822.1.3042 WP_000427822.1.30421 WP_000427822.1.30437 WP_000427822.1.30440 WP_000427822.1.30489 WP_000427822.1.30492 WP_000427822.1.30517 WP_000427822.1.30542 WP_000427822.1.30544 WP_000427822.1.30548 WP_000427822.1.30556 WP_000427822.1.30572 WP_000427822.1.30573 WP_000427822.1.30585 WP_000427822.1.30589 WP_000427822.1.30618 WP_000427822.1.30627 WP_000427822.1.3066 WP_000427822.1.30664 WP_000427822.1.3067 WP_000427822.1.30688 WP_000427822.1.30696 WP_000427822.1.3080 WP_000427822.1.30806 WP_000427822.1.30819 WP_000427822.1.30909 WP_000427822.1.3095 WP_000427822.1.30967 WP_000427822.1.31001 WP_000427822.1.31046 WP_000427822.1.31066 WP_000427822.1.31078 WP_000427822.1.31086 WP_000427822.1.31107 WP_000427822.1.31111 WP_000427822.1.31139 WP_000427822.1.31145 WP_000427822.1.31155 WP_000427822.1.31156 WP_000427822.1.31171 WP_000427822.1.31182 WP_000427822.1.31205 WP_000427822.1.3121 WP_000427822.1.31210 WP_000427822.1.31222 WP_000427822.1.31223 WP_000427822.1.3127 WP_000427822.1.31303 WP_000427822.1.3131 WP_000427822.1.31352 WP_000427822.1.31389 WP_000427822.1.31413 WP_000427822.1.31435 WP_000427822.1.31446 WP_000427822.1.31476 WP_000427822.1.3167 WP_000427822.1.31725 WP_000427822.1.31762 WP_000427822.1.31799 WP_000427822.1.31836 WP_000427822.1.31845 WP_000427822.1.31854 WP_000427822.1.31895 WP_000427822.1.31927 WP_000427822.1.31951 WP_000427822.1.31983 WP_000427822.1.32006 WP_000427822.1.32038 WP_000427822.1.32041 WP_000427822.1.32042 WP_000427822.1.32054 WP_000427822.1.3207 WP_000427822.1.32109 WP_000427822.1.32116 WP_000427822.1.32189 WP_000427822.1.32202 WP_000427822.1.32252 WP_000427822.1.32255 WP_000427822.1.32263 WP_000427822.1.32277 WP_000427822.1.32293 WP_000427822.1.32299 WP_000427822.1.32422 WP_000427822.1.32423 WP_000427822.1.32424 WP_000427822.1.32425 WP_000427822.1.32458 WP_000427822.1.32459 WP_000427822.1.32460 WP_000427822.1.32493 WP_000427822.1.32529 WP_000427822.1.32563 WP_000427822.1.32578 WP_000427822.1.32617 WP_000427822.1.32624 WP_000427822.1.32668 WP_000427822.1.3270 WP_000427822.1.32725 WP_000427822.1.32747 WP_000427822.1.3278 WP_000427822.1.32838 WP_000427822.1.32848 WP_000427822.1.32868 WP_000427822.1.32881 WP_000427822.1.3290 WP_000427822.1.32902 WP_000427822.1.32940 WP_000427822.1.32941 WP_000427822.1.3296 WP_000427822.1.32961 WP_000427822.1.32966 WP_000427822.1.32977 WP_000427822.1.32985 WP_000427822.1.33010 WP_000427822.1.33037 WP_000427822.1.3305 WP_000427822.1.33051 WP_000427822.1.33065 WP_000427822.1.33078 WP_000427822.1.33122 WP_000427822.1.33144 WP_000427822.1.3315 WP_000427822.1.33160 WP_000427822.1.33208 WP_000427822.1.33214 WP_000427822.1.33247 WP_000427822.1.33270 WP_000427822.1.33280 WP_000427822.1.33283 WP_000427822.1.33313 WP_000427822.1.33339 WP_000427822.1.33382 WP_000427822.1.33409 WP_000427822.1.33486 WP_000427822.1.33490 WP_000427822.1.33499 WP_000427822.1.335 WP_000427822.1.33501 WP_000427822.1.33529 WP_000427822.1.3356 WP_000427822.1.33609 WP_000427822.1.3364 WP_000427822.1.33659 WP_000427822.1.33689 WP_000427822.1.3370 WP_000427822.1.33730 WP_000427822.1.33741 WP_000427822.1.33840 WP_000427822.1.33865 WP_000427822.1.3392 WP_000427822.1.33926 WP_000427822.1.33957 WP_000427822.1.33969 WP_000427822.1.34 WP_000427822.1.34001 WP_000427822.1.34022 WP_000427822.1.34059 WP_000427822.1.34081 WP_000427822.1.34084 WP_000427822.1.34091 WP_000427822.1.34118 WP_000427822.1.34126 WP_000427822.1.34211 WP_000427822.1.34214 WP_000427822.1.34234 WP_000427822.1.34284 WP_000427822.1.34292 WP_000427822.1.34304 WP_000427822.1.34376 WP_000427822.1.3438 WP_000427822.1.34382 WP_000427822.1.3445 WP_000427822.1.34484 WP_000427822.1.34496 WP_000427822.1.34517 WP_000427822.1.34530 WP_000427822.1.34614 WP_000427822.1.34647 WP_000427822.1.34659 WP_000427822.1.34665 WP_000427822.1.34667 WP_000427822.1.34684 WP_000427822.1.34694 WP_000427822.1.34704 WP_000427822.1.34711 WP_000427822.1.34745 WP_000427822.1.34751 WP_000427822.1.3476 WP_000427822.1.34808 WP_000427822.1.34817 WP_000427822.1.34820 WP_000427822.1.34824 WP_000427822.1.34834 WP_000427822.1.34881 WP_000427822.1.34932 WP_000427822.1.34962 WP_000427822.1.35001 WP_000427822.1.35040 WP_000427822.1.35074 WP_000427822.1.35125 WP_000427822.1.35175 WP_000427822.1.35219 WP_000427822.1.35240 WP_000427822.1.35274 WP_000427822.1.35294 WP_000427822.1.35298 WP_000427822.1.35321 WP_000427822.1.35332 WP_000427822.1.3541 WP_000427822.1.35494 WP_000427822.1.35532 WP_000427822.1.35560 WP_000427822.1.3557 WP_000427822.1.35570 WP_000427822.1.35619 WP_000427822.1.35624 WP_000427822.1.35628 WP_000427822.1.35648 WP_000427822.1.3566 WP_000427822.1.3570 WP_000427822.1.35712 WP_000427822.1.35713 WP_000427822.1.3572 WP_000427822.1.35736 WP_000427822.1.35777 WP_000427822.1.35791 WP_000427822.1.35795 WP_000427822.1.35835 WP_000427822.1.35868 WP_000427822.1.35870 WP_000427822.1.35916 WP_000427822.1.35936 WP_000427822.1.35938 WP_000427822.1.35961 WP_000427822.1.35966 WP_000427822.1.36000 WP_000427822.1.36011 WP_000427822.1.36034 WP_000427822.1.36036 WP_000427822.1.36063 WP_000427822.1.36069 WP_000427822.1.36157 WP_000427822.1.36172 WP_000427822.1.36229 WP_000427822.1.36286 WP_000427822.1.36291 WP_000427822.1.36298 WP_000427822.1.36308 WP_000427822.1.36323 WP_000427822.1.36343 WP_000427822.1.36409 WP_000427822.1.36445 WP_000427822.1.36460 WP_000427822.1.3649 WP_000427822.1.36495 WP_000427822.1.36512 WP_000427822.1.36526 WP_000427822.1.36542 WP_000427822.1.36567 WP_000427822.1.36579 WP_000427822.1.36584 WP_000427822.1.36592 WP_000427822.1.36617 WP_000427822.1.36618 WP_000427822.1.36643 WP_000427822.1.36663 WP_000427822.1.36701 WP_000427822.1.36721 WP_000427822.1.36725 WP_000427822.1.36751 WP_000427822.1.36764 WP_000427822.1.36779 WP_000427822.1.36798 WP_000427822.1.36821 WP_000427822.1.36853 WP_000427822.1.36885 WP_000427822.1.36948 WP_000427822.1.36949 WP_000427822.1.36950 WP_000427822.1.36978 WP_000427822.1.37013 WP_000427822.1.37014 WP_000427822.1.37021 WP_000427822.1.37029 WP_000427822.1.37100 WP_000427822.1.37133 WP_000427822.1.37147 WP_000427822.1.37158 WP_000427822.1.37176 WP_000427822.1.37190 WP_000427822.1.37199 WP_000427822.1.37200 WP_000427822.1.37258 WP_000427822.1.3726 WP_000427822.1.37267 WP_000427822.1.3728 WP_000427822.1.37297 WP_000427822.1.37303 WP_000427822.1.37320 WP_000427822.1.3734 WP_000427822.1.3748 WP_000427822.1.37513 WP_000427822.1.37558 WP_000427822.1.3756 WP_000427822.1.37584 WP_000427822.1.37590 WP_000427822.1.37593 WP_000427822.1.37600 WP_000427822.1.37610 WP_000427822.1.37613 WP_000427822.1.37659 WP_000427822.1.37662 WP_000427822.1.37675 WP_000427822.1.37691 WP_000427822.1.37761 WP_000427822.1.37775 WP_000427822.1.37777 WP_000427822.1.3778 WP_000427822.1.378 WP_000427822.1.37808 WP_000427822.1.37864 WP_000427822.1.379 WP_000427822.1.3790 WP_000427822.1.37911 WP_000427822.1.37941 WP_000427822.1.37965 WP_000427822.1.37985 WP_000427822.1.38001 WP_000427822.1.38026 WP_000427822.1.38037 WP_000427822.1.38047 WP_000427822.1.38055 WP_000427822.1.38061 WP_000427822.1.38064 WP_000427822.1.38108 WP_000427822.1.38113 WP_000427822.1.3816 WP_000427822.1.38199 WP_000427822.1.38207 WP_000427822.1.38261 WP_000427822.1.38266 WP_000427822.1.38273 WP_000427822.1.3828 WP_000427822.1.38310 WP_000427822.1.3834 WP_000427822.1.38351 WP_000427822.1.3838 WP_000427822.1.38381 WP_000427822.1.38440 WP_000427822.1.38515 WP_000427822.1.38595 WP_000427822.1.3860 WP_000427822.1.38642 WP_000427822.1.38734 WP_000427822.1.38740 WP_000427822.1.38877 WP_000427822.1.38881 WP_000427822.1.38895 WP_000427822.1.38983 WP_000427822.1.38995 WP_000427822.1.38996 WP_000427822.1.39055 WP_000427822.1.39056 WP_000427822.1.39065 WP_000427822.1.3907 WP_000427822.1.39105 WP_000427822.1.39113 WP_000427822.1.3914 WP_000427822.1.39147 WP_000427822.1.39161 WP_000427822.1.39210 WP_000427822.1.39235 WP_000427822.1.3931 WP_000427822.1.39312 WP_000427822.1.39395 WP_000427822.1.39414 WP_000427822.1.39435 WP_000427822.1.39471 WP_000427822.1.39502 WP_000427822.1.39503 WP_000427822.1.39530 WP_000427822.1.39614 WP_000427822.1.39619 WP_000427822.1.39620 WP_000427822.1.39624 WP_000427822.1.39632 WP_000427822.1.39659 WP_000427822.1.39667 WP_000427822.1.39723 WP_000427822.1.39775 WP_000427822.1.39879 WP_000427822.1.39890 WP_000427822.1.39941 WP_000427822.1.39945 WP_000427822.1.39947 WP_000427822.1.40081 WP_000427822.1.40095 WP_000427822.1.40097 WP_000427822.1.401 WP_000427822.1.40111 WP_000427822.1.40158 WP_000427822.1.40160 WP_000427822.1.40167 WP_000427822.1.40224 WP_000427822.1.40279 WP_000427822.1.40284 WP_000427822.1.40307 WP_000427822.1.40361 WP_000427822.1.4042 WP_000427822.1.40467 WP_000427822.1.40492 WP_000427822.1.40493 WP_000427822.1.40496 WP_000427822.1.40517 WP_000427822.1.40533 WP_000427822.1.40577 WP_000427822.1.40605 WP_000427822.1.40622 WP_000427822.1.40648 WP_000427822.1.40693 WP_000427822.1.40695 WP_000427822.1.40698 WP_000427822.1.40745 WP_000427822.1.40750 WP_000427822.1.40763 WP_000427822.1.40771 WP_000427822.1.40854 WP_000427822.1.4088 WP_000427822.1.4089 WP_000427822.1.40910 WP_000427822.1.40924 WP_000427822.1.40930 WP_000427822.1.40932 WP_000427822.1.40935 WP_000427822.1.40946 WP_000427822.1.40979 WP_000427822.1.41004 WP_000427822.1.41048 WP_000427822.1.41050 WP_000427822.1.4106 WP_000427822.1.41070 WP_000427822.1.41074 WP_000427822.1.41075 WP_000427822.1.4109 WP_000427822.1.41097 WP_000427822.1.41116 WP_000427822.1.41128 WP_000427822.1.41132 WP_000427822.1.41176 WP_000427822.1.41192 WP_000427822.1.41251 WP_000427822.1.41258 WP_000427822.1.41265 WP_000427822.1.41277 WP_000427822.1.41299 WP_000427822.1.41305 WP_000427822.1.41308 WP_000427822.1.41310 WP_000427822.1.41321 WP_000427822.1.41333 WP_000427822.1.41335 WP_000427822.1.41345 WP_000427822.1.4136 WP_000427822.1.4141 WP_000427822.1.41415 WP_000427822.1.41427 WP_000427822.1.41434 WP_000427822.1.41438 WP_000427822.1.41459 WP_000427822.1.41468 WP_000427822.1.41498 WP_000427822.1.41519 WP_000427822.1.41524 WP_000427822.1.41528 WP_000427822.1.41593 WP_000427822.1.41610 WP_000427822.1.41628 WP_000427822.1.41631 WP_000427822.1.41658 WP_000427822.1.41659 WP_000427822.1.41688 WP_000427822.1.41690 WP_000427822.1.41716 WP_000427822.1.41724 WP_000427822.1.41746 WP_000427822.1.4178 WP_000427822.1.41789 WP_000427822.1.41802 WP_000427822.1.41824 WP_000427822.1.41825 WP_000427822.1.41836 WP_000427822.1.4184 WP_000427822.1.41862 WP_000427822.1.41894 WP_000427822.1.41897 WP_000427822.1.41919 WP_000427822.1.41929 WP_000427822.1.41931 WP_000427822.1.41938 WP_000427822.1.4194 WP_000427822.1.41998 WP_000427822.1.42009 WP_000427822.1.42069 WP_000427822.1.42081 WP_000427822.1.42090 WP_000427822.1.42187 WP_000427822.1.422 WP_000427822.1.42200 WP_000427822.1.42219 WP_000427822.1.42238 WP_000427822.1.42248 WP_000427822.1.42257 WP_000427822.1.42261 WP_000427822.1.42276 WP_000427822.1.42328 WP_000427822.1.42349 WP_000427822.1.42356 WP_000427822.1.42364 WP_000427822.1.42371 WP_000427822.1.42379 WP_000427822.1.4239 WP_000427822.1.42391 WP_000427822.1.42399 WP_000427822.1.42404 WP_000427822.1.42453 WP_000427822.1.42491 WP_000427822.1.42539 WP_000427822.1.4257 WP_000427822.1.42595 WP_000427822.1.42603 WP_000427822.1.42605 WP_000427822.1.42650 WP_000427822.1.42666 WP_000427822.1.4267 WP_000427822.1.42675 WP_000427822.1.42683 WP_000427822.1.42701 WP_000427822.1.42707 WP_000427822.1.42734 WP_000427822.1.42767 WP_000427822.1.42797 WP_000427822.1.42805 WP_000427822.1.42815 WP_000427822.1.42829 WP_000427822.1.42859 WP_000427822.1.42861 WP_000427822.1.42887 WP_000427822.1.4289 WP_000427822.1.42892 WP_000427822.1.42957 WP_000427822.1.4298 WP_000427822.1.42981 WP_000427822.1.43008 WP_000427822.1.43016 WP_000427822.1.43019 WP_000427822.1.43065 WP_000427822.1.43068 WP_000427822.1.43069 WP_000427822.1.43086 WP_000427822.1.43128 WP_000427822.1.43141 WP_000427822.1.43157 WP_000427822.1.43161 WP_000427822.1.43190 WP_000427822.1.43198 WP_000427822.1.43201 WP_000427822.1.4326 WP_000427822.1.43290 WP_000427822.1.43292 WP_000427822.1.43299 WP_000427822.1.43307 WP_000427822.1.43438 WP_000427822.1.4344 WP_000427822.1.43513 WP_000427822.1.43528 WP_000427822.1.43535 WP_000427822.1.43633 WP_000427822.1.43637 WP_000427822.1.43651 WP_000427822.1.43654 WP_000427822.1.43676 WP_000427822.1.43685 WP_000427822.1.43710 WP_000427822.1.43711 WP_000427822.1.43722 WP_000427822.1.43763 WP_000427822.1.43801 WP_000427822.1.43812 WP_000427822.1.43828 WP_000427822.1.43873 WP_000427822.1.43875 WP_000427822.1.43878 WP_000427822.1.43888 WP_000427822.1.43919 WP_000427822.1.43954 WP_000427822.1.43974 WP_000427822.1.44010 WP_000427822.1.44049 WP_000427822.1.4405 WP_000427822.1.44101 WP_000427822.1.44160 WP_000427822.1.44180 WP_000427822.1.44187 WP_000427822.1.44191 WP_000427822.1.44196 WP_000427822.1.44248 WP_000427822.1.44262 WP_000427822.1.44268 WP_000427822.1.4427 WP_000427822.1.44296 WP_000427822.1.44337 WP_000427822.1.44339 WP_000427822.1.44343 WP_000427822.1.44351 WP_000427822.1.44359 WP_000427822.1.44360 WP_000427822.1.44397 WP_000427822.1.44416 WP_000427822.1.44431 WP_000427822.1.44437 WP_000427822.1.44438 WP_000427822.1.44440 WP_000427822.1.44443 WP_000427822.1.44453 WP_000427822.1.44546 WP_000427822.1.44549 WP_000427822.1.44593 WP_000427822.1.44633 WP_000427822.1.44636 WP_000427822.1.44678 WP_000427822.1.4468 WP_000427822.1.44702 WP_000427822.1.44762 WP_000427822.1.44781 WP_000427822.1.44795 WP_000427822.1.44815 WP_000427822.1.44828 WP_000427822.1.44831 WP_000427822.1.44833 WP_000427822.1.44879 WP_000427822.1.44887 WP_000427822.1.44917 WP_000427822.1.44943 WP_000427822.1.44950 WP_000427822.1.44978 WP_000427822.1.44997 WP_000427822.1.4500 WP_000427822.1.4501 WP_000427822.1.45027 WP_000427822.1.45093 WP_000427822.1.45123 WP_000427822.1.45134 WP_000427822.1.45136 WP_000427822.1.45154 WP_000427822.1.45173 WP_000427822.1.45241 WP_000427822.1.45302 WP_000427822.1.4531 WP_000427822.1.45432 WP_000427822.1.45435 WP_000427822.1.45462 WP_000427822.1.45468 WP_000427822.1.45522 WP_000427822.1.45523 WP_000427822.1.45535 WP_000427822.1.45544 WP_000427822.1.45549 WP_000427822.1.45569 WP_000427822.1.45571 WP_000427822.1.45583 WP_000427822.1.45596 WP_000427822.1.45648 WP_000427822.1.45706 WP_000427822.1.45829 WP_000427822.1.45871 WP_000427822.1.45906 WP_000427822.1.45918 WP_000427822.1.4592 WP_000427822.1.46028 WP_000427822.1.46030 WP_000427822.1.46077 WP_000427822.1.46169 WP_000427822.1.46203 WP_000427822.1.46225 WP_000427822.1.46241 WP_000427822.1.46243 WP_000427822.1.46250 WP_000427822.1.46286 WP_000427822.1.46299 WP_000427822.1.46307 WP_000427822.1.46322 WP_000427822.1.46358 WP_000427822.1.464 WP_000427822.1.46406 WP_000427822.1.46444 WP_000427822.1.46454 WP_000427822.1.46499 WP_000427822.1.46504 WP_000427822.1.46505 WP_000427822.1.46551 WP_000427822.1.46559 WP_000427822.1.46574 WP_000427822.1.46637 WP_000427822.1.46666 WP_000427822.1.46693 WP_000427822.1.46701 WP_000427822.1.4671 WP_000427822.1.46726 WP_000427822.1.46732 WP_000427822.1.46781 WP_000427822.1.46816 WP_000427822.1.4686 WP_000427822.1.4690 WP_000427822.1.46920 WP_000427822.1.46945 WP_000427822.1.46961 WP_000427822.1.46976 WP_000427822.1.47036 WP_000427822.1.47037 WP_000427822.1.47042 WP_000427822.1.47059 WP_000427822.1.47085 WP_000427822.1.47123 WP_000427822.1.47215 WP_000427822.1.47245 WP_000427822.1.47442 WP_000427822.1.47460 WP_000427822.1.47492 WP_000427822.1.47507 WP_000427822.1.47523 WP_000427822.1.47531 WP_000427822.1.47532 WP_000427822.1.47567 WP_000427822.1.47576 WP_000427822.1.47605 WP_000427822.1.47614 WP_000427822.1.47630 WP_000427822.1.47649 WP_000427822.1.47714 WP_000427822.1.4774 WP_000427822.1.4775 WP_000427822.1.47756 WP_000427822.1.47767 WP_000427822.1.4781 WP_000427822.1.47814 WP_000427822.1.47817 WP_000427822.1.47849 WP_000427822.1.47850 WP_000427822.1.47875 WP_000427822.1.47886 WP_000427822.1.47898 WP_000427822.1.47902 WP_000427822.1.47911 WP_000427822.1.47928 WP_000427822.1.4795 WP_000427822.1.47992 WP_000427822.1.48019 WP_000427822.1.48100 WP_000427822.1.48114 WP_000427822.1.48124 WP_000427822.1.48139 WP_000427822.1.48190 WP_000427822.1.48209 WP_000427822.1.48215 WP_000427822.1.48218 WP_000427822.1.48247 WP_000427822.1.48268 WP_000427822.1.48292 WP_000427822.1.48324 WP_000427822.1.4839 WP_000427822.1.48426 WP_000427822.1.48430 WP_000427822.1.48436 WP_000427822.1.48524 WP_000427822.1.48570 WP_000427822.1.48586 WP_000427822.1.4859 WP_000427822.1.48591 WP_000427822.1.48610 WP_000427822.1.48631 WP_000427822.1.48651 WP_000427822.1.48663 WP_000427822.1.48690 WP_000427822.1.48734 WP_000427822.1.48751 WP_000427822.1.48755 WP_000427822.1.48756 WP_000427822.1.48774 WP_000427822.1.48778 WP_000427822.1.48849 WP_000427822.1.48876 WP_000427822.1.48886 WP_000427822.1.48955 WP_000427822.1.48963 WP_000427822.1.48973 WP_000427822.1.48985 WP_000427822.1.49004 WP_000427822.1.49005 WP_000427822.1.49090 WP_000427822.1.49102 WP_000427822.1.49106 WP_000427822.1.49117 WP_000427822.1.49121 WP_000427822.1.4914 WP_000427822.1.49140 WP_000427822.1.49153 WP_000427822.1.49175 WP_000427822.1.49214 WP_000427822.1.49226 WP_000427822.1.49233 WP_000427822.1.49262 WP_000427822.1.49276 WP_000427822.1.49304 WP_000427822.1.49309 WP_000427822.1.49311 WP_000427822.1.49355 WP_000427822.1.49429 WP_000427822.1.49434 WP_000427822.1.49450 WP_000427822.1.49472 WP_000427822.1.495 WP_000427822.1.49545 WP_000427822.1.49574 WP_000427822.1.49626 WP_000427822.1.49647 WP_000427822.1.49703 WP_000427822.1.49769 WP_000427822.1.49827 WP_000427822.1.49846 WP_000427822.1.49848 WP_000427822.1.4991 WP_000427822.1.49931 WP_000427822.1.49947 WP_000427822.1.49959 WP_000427822.1.49997 WP_000427822.1.50003 WP_000427822.1.50007 WP_000427822.1.50014 WP_000427822.1.50030 WP_000427822.1.50043 WP_000427822.1.5009 WP_000427822.1.50103 WP_000427822.1.50128 WP_000427822.1.50158 WP_000427822.1.50198 WP_000427822.1.50247 WP_000427822.1.50285 WP_000427822.1.50308 WP_000427822.1.50309 WP_000427822.1.50386 WP_000427822.1.50387 WP_000427822.1.50406 WP_000427822.1.50449 WP_000427822.1.50468 WP_000427822.1.50469 WP_000427822.1.50480 WP_000427822.1.50497 WP_000427822.1.5051 WP_000427822.1.50563 WP_000427822.1.50565 WP_000427822.1.50566 WP_000427822.1.50570 WP_000427822.1.50593 WP_000427822.1.50626 WP_000427822.1.50652 WP_000427822.1.50684 WP_000427822.1.50726 WP_000427822.1.50769 WP_000427822.1.50771 WP_000427822.1.50777 WP_000427822.1.50800 WP_000427822.1.50811 WP_000427822.1.50875 WP_000427822.1.50882 WP_000427822.1.50885 WP_000427822.1.509 WP_000427822.1.50905 WP_000427822.1.50918 WP_000427822.1.50929 WP_000427822.1.50954 WP_000427822.1.50960 WP_000427822.1.50970 WP_000427822.1.51025 WP_000427822.1.51036 WP_000427822.1.51040 WP_000427822.1.51048 WP_000427822.1.51100 WP_000427822.1.51117 WP_000427822.1.51134 WP_000427822.1.5114 WP_000427822.1.51162 WP_000427822.1.51227 WP_000427822.1.5125 WP_000427822.1.5127 WP_000427822.1.51305 WP_000427822.1.51308 WP_000427822.1.51315 WP_000427822.1.51331 WP_000427822.1.51356 WP_000427822.1.5136 WP_000427822.1.51394 WP_000427822.1.51412 WP_000427822.1.51451 WP_000427822.1.51474 WP_000427822.1.51502 WP_000427822.1.51506 WP_000427822.1.51514 WP_000427822.1.51518 WP_000427822.1.51519 WP_000427822.1.51555 WP_000427822.1.51598 WP_000427822.1.51611 WP_000427822.1.51613 WP_000427822.1.51642 WP_000427822.1.51704 WP_000427822.1.51724 WP_000427822.1.51734 WP_000427822.1.51764 WP_000427822.1.51838 WP_000427822.1.51863 WP_000427822.1.51868 WP_000427822.1.51888 WP_000427822.1.51900 WP_000427822.1.51910 WP_000427822.1.51914 WP_000427822.1.51930 WP_000427822.1.51935 WP_000427822.1.51994 WP_000427822.1.520 WP_000427822.1.52047 WP_000427822.1.52057 WP_000427822.1.52114 WP_000427822.1.52123 WP_000427822.1.52129 WP_000427822.1.5216 WP_000427822.1.52161 WP_000427822.1.52191 WP_000427822.1.52202 WP_000427822.1.52209 WP_000427822.1.52301 WP_000427822.1.52321 WP_000427822.1.52339 WP_000427822.1.52438 WP_000427822.1.52456 WP_000427822.1.52469 WP_000427822.1.52527 WP_000427822.1.52528 WP_000427822.1.52571 WP_000427822.1.52586 WP_000427822.1.526 WP_000427822.1.52608 WP_000427822.1.52647 WP_000427822.1.52742 WP_000427822.1.52748 WP_000427822.1.52773 WP_000427822.1.52795 WP_000427822.1.52807 WP_000427822.1.52833 WP_000427822.1.52851 WP_000427822.1.52887 WP_000427822.1.52924 WP_000427822.1.5301 WP_000427822.1.53100 WP_000427822.1.5313 WP_000427822.1.53141 WP_000427822.1.53151 WP_000427822.1.53154 WP_000427822.1.53158 WP_000427822.1.53159 WP_000427822.1.5316 WP_000427822.1.53198 WP_000427822.1.53206 WP_000427822.1.53210 WP_000427822.1.53233 WP_000427822.1.53234 WP_000427822.1.53274 WP_000427822.1.53307 WP_000427822.1.53315 WP_000427822.1.53316 WP_000427822.1.53321 WP_000427822.1.5333 WP_000427822.1.53362 WP_000427822.1.53368 WP_000427822.1.53375 WP_000427822.1.53385 WP_000427822.1.53450 WP_000427822.1.53454 WP_000427822.1.5349 WP_000427822.1.53540 WP_000427822.1.53555 WP_000427822.1.53559 WP_000427822.1.5356 WP_000427822.1.53567 WP_000427822.1.53571 WP_000427822.1.5358 WP_000427822.1.53664 WP_000427822.1.53675 WP_000427822.1.53692 WP_000427822.1.53694 WP_000427822.1.53696 WP_000427822.1.5374 WP_000427822.1.53750 WP_000427822.1.53772 WP_000427822.1.53778 WP_000427822.1.53800 WP_000427822.1.53814 WP_000427822.1.53815 WP_000427822.1.53839 WP_000427822.1.53892 WP_000427822.1.53896 WP_000427822.1.53898 WP_000427822.1.53902 WP_000427822.1.5392 WP_000427822.1.53935 WP_000427822.1.53958 WP_000427822.1.53961 WP_000427822.1.53981 WP_000427822.1.53984 WP_000427822.1.54061 WP_000427822.1.54082 WP_000427822.1.54132 WP_000427822.1.5415 WP_000427822.1.54159 WP_000427822.1.54170 WP_000427822.1.54175 WP_000427822.1.54203 WP_000427822.1.54259 WP_000427822.1.5430 WP_000427822.1.54333 WP_000427822.1.54366 WP_000427822.1.54371 WP_000427822.1.54431 WP_000427822.1.54442 WP_000427822.1.54469 WP_000427822.1.54482 WP_000427822.1.54500 WP_000427822.1.54558 WP_000427822.1.54569 WP_000427822.1.54589 WP_000427822.1.54607 WP_000427822.1.54667 WP_000427822.1.54678 WP_000427822.1.54681 WP_000427822.1.54694 WP_000427822.1.54748 WP_000427822.1.54774 WP_000427822.1.5481 WP_000427822.1.54822 WP_000427822.1.54827 WP_000427822.1.54833 WP_000427822.1.5485 WP_000427822.1.54865 WP_000427822.1.54877 WP_000427822.1.54935 WP_000427822.1.54979 WP_000427822.1.54984 WP_000427822.1.55010 WP_000427822.1.55034 WP_000427822.1.55163 WP_000427822.1.55165 WP_000427822.1.55166 WP_000427822.1.5517 WP_000427822.1.55215 WP_000427822.1.55223 WP_000427822.1.55224 WP_000427822.1.5527 WP_000427822.1.55294 WP_000427822.1.55310 WP_000427822.1.55317 WP_000427822.1.55379 WP_000427822.1.5539 WP_000427822.1.55418 WP_000427822.1.55461 WP_000427822.1.55468 WP_000427822.1.55477 WP_000427822.1.55496 WP_000427822.1.55506 WP_000427822.1.55545 WP_000427822.1.55554 WP_000427822.1.55604 WP_000427822.1.55614 WP_000427822.1.55639 WP_000427822.1.55699 WP_000427822.1.55706 WP_000427822.1.55718 WP_000427822.1.5572 WP_000427822.1.55725 WP_000427822.1.5577 WP_000427822.1.55780 WP_000427822.1.55803 WP_000427822.1.55853 WP_000427822.1.55923 WP_000427822.1.55967 WP_000427822.1.56004 WP_000427822.1.56059 WP_000427822.1.56082 WP_000427822.1.56130 WP_000427822.1.56144 WP_000427822.1.56172 WP_000427822.1.5621 WP_000427822.1.56222 WP_000427822.1.56226 WP_000427822.1.56235 WP_000427822.1.56247 WP_000427822.1.56263 WP_000427822.1.56311 WP_000427822.1.56354 WP_000427822.1.56368 WP_000427822.1.56385 WP_000427822.1.56389 WP_000427822.1.56393 WP_000427822.1.56413 WP_000427822.1.56419 WP_000427822.1.56423 WP_000427822.1.56512 WP_000427822.1.56535 WP_000427822.1.56585 WP_000427822.1.56640 WP_000427822.1.56642 WP_000427822.1.56651 WP_000427822.1.56724 WP_000427822.1.56825 WP_000427822.1.56853 WP_000427822.1.56861 WP_000427822.1.56887 WP_000427822.1.56889 WP_000427822.1.56893 WP_000427822.1.56898 WP_000427822.1.56905 WP_000427822.1.56950 WP_000427822.1.56981 WP_000427822.1.57026 WP_000427822.1.57039 WP_000427822.1.57076 WP_000427822.1.57084 WP_000427822.1.57101 WP_000427822.1.5711 WP_000427822.1.57125 WP_000427822.1.57137 WP_000427822.1.57143 WP_000427822.1.57147 WP_000427822.1.57149 WP_000427822.1.57179 WP_000427822.1.57186 WP_000427822.1.57246 WP_000427822.1.57296 WP_000427822.1.57307 WP_000427822.1.57342 WP_000427822.1.57344 WP_000427822.1.57357 WP_000427822.1.57399 WP_000427822.1.57495 WP_000427822.1.57521 WP_000427822.1.57534 WP_000427822.1.57555 WP_000427822.1.57559 WP_000427822.1.57641 WP_000427822.1.57684 WP_000427822.1.57699 WP_000427822.1.57735 WP_000427822.1.57785 WP_000427822.1.57797 WP_000427822.1.57800 WP_000427822.1.5781 WP_000427822.1.57857 WP_000427822.1.57873 WP_000427822.1.57893 WP_000427822.1.57902 WP_000427822.1.58008 WP_000427822.1.58040 WP_000427822.1.58044 WP_000427822.1.58081 WP_000427822.1.5809 WP_000427822.1.58090 WP_000427822.1.58131 WP_000427822.1.58132 WP_000427822.1.58144 WP_000427822.1.58157 WP_000427822.1.58173 WP_000427822.1.58191 WP_000427822.1.58194 WP_000427822.1.58239 WP_000427822.1.58249 WP_000427822.1.58251 WP_000427822.1.58252 WP_000427822.1.58261 WP_000427822.1.58274 WP_000427822.1.5828 WP_000427822.1.58282 WP_000427822.1.58301 WP_000427822.1.58324 WP_000427822.1.58326 WP_000427822.1.58357 WP_000427822.1.5836 WP_000427822.1.58372 WP_000427822.1.58416 WP_000427822.1.58442 WP_000427822.1.58443 WP_000427822.1.58485 WP_000427822.1.58486 WP_000427822.1.58489 WP_000427822.1.58537 WP_000427822.1.58568 WP_000427822.1.58583 WP_000427822.1.58652 WP_000427822.1.58663 WP_000427822.1.58675 WP_000427822.1.58698 WP_000427822.1.587 WP_000427822.1.58724 WP_000427822.1.58729 WP_000427822.1.58749 WP_000427822.1.5875 WP_000427822.1.58796 WP_000427822.1.58807 WP_000427822.1.58834 WP_000427822.1.58847 WP_000427822.1.58861 WP_000427822.1.58883 WP_000427822.1.58884 WP_000427822.1.58898 WP_000427822.1.58932 WP_000427822.1.58949 WP_000427822.1.58963 WP_000427822.1.58970 WP_000427822.1.58974 WP_000427822.1.59006 WP_000427822.1.59020 WP_000427822.1.59043 WP_000427822.1.59056 WP_000427822.1.59061 WP_000427822.1.59064 WP_000427822.1.59097 WP_000427822.1.59125 WP_000427822.1.59136 WP_000427822.1.59142 WP_000427822.1.59148 WP_000427822.1.59163 WP_000427822.1.59282 WP_000427822.1.5929 WP_000427822.1.59294 WP_000427822.1.59299 WP_000427822.1.59313 WP_000427822.1.59335 WP_000427822.1.59336 WP_000427822.1.59381 WP_000427822.1.59427 WP_000427822.1.59486 WP_000427822.1.5949 WP_000427822.1.59501 WP_000427822.1.59510 WP_000427822.1.59512 WP_000427822.1.59548 WP_000427822.1.59562 WP_000427822.1.59587 WP_000427822.1.59636 WP_000427822.1.59641 WP_000427822.1.59646 WP_000427822.1.5969 WP_000427822.1.59751 WP_000427822.1.59755 WP_000427822.1.59827 WP_000427822.1.59829 WP_000427822.1.59830 WP_000427822.1.59847 WP_000427822.1.59848 WP_000427822.1.59863 WP_000427822.1.59928 WP_000427822.1.59969 WP_000427822.1.59979 WP_000427822.1.59994 WP_000427822.1.60004 WP_000427822.1.60045 WP_000427822.1.60052 WP_000427822.1.60076 WP_000427822.1.60114 WP_000427822.1.60154 WP_000427822.1.60168 WP_000427822.1.60192 WP_000427822.1.60199 WP_000427822.1.60212 WP_000427822.1.60213 WP_000427822.1.60231 WP_000427822.1.60253 WP_000427822.1.60324 WP_000427822.1.6033 WP_000427822.1.60330 WP_000427822.1.60356 WP_000427822.1.60370 WP_000427822.1.6038 WP_000427822.1.60380 WP_000427822.1.6041 WP_000427822.1.60424 WP_000427822.1.60425 WP_000427822.1.60469 WP_000427822.1.60481 WP_000427822.1.60486 WP_000427822.1.605 WP_000427822.1.60503 WP_000427822.1.60507 WP_000427822.1.60560 WP_000427822.1.6058 WP_000427822.1.60584 WP_000427822.1.60597 WP_000427822.1.6060 WP_000427822.1.60608 WP_000427822.1.60622 WP_000427822.1.60643 WP_000427822.1.60676 WP_000427822.1.60708 WP_000427822.1.60713 WP_000427822.1.60725 WP_000427822.1.60746 WP_000427822.1.60760 WP_000427822.1.60783 WP_000427822.1.60792 WP_000427822.1.608 WP_000427822.1.60807 WP_000427822.1.60838 WP_000427822.1.60855 WP_000427822.1.60863 WP_000427822.1.60866 WP_000427822.1.60882 WP_000427822.1.60889 WP_000427822.1.60919 WP_000427822.1.60926 WP_000427822.1.60950 WP_000427822.1.60990 WP_000427822.1.6104 WP_000427822.1.61044 WP_000427822.1.61076 WP_000427822.1.6108 WP_000427822.1.61087 WP_000427822.1.61123 WP_000427822.1.61147 WP_000427822.1.61168 WP_000427822.1.61184 WP_000427822.1.61210 WP_000427822.1.61218 WP_000427822.1.61233 WP_000427822.1.61356 WP_000427822.1.61357 WP_000427822.1.61381 WP_000427822.1.61497 WP_000427822.1.61501 WP_000427822.1.61509 WP_000427822.1.61511 WP_000427822.1.61539 WP_000427822.1.61542 WP_000427822.1.61553 WP_000427822.1.61594 WP_000427822.1.6164 WP_000427822.1.61649 WP_000427822.1.61652 WP_000427822.1.61662 WP_000427822.1.61697 WP_000427822.1.61732 WP_000427822.1.61783 WP_000427822.1.61809 WP_000427822.1.61877 WP_000427822.1.6190 WP_000427822.1.61920 WP_000427822.1.61922 WP_000427822.1.62076 WP_000427822.1.6210 WP_000427822.1.62124 WP_000427822.1.62142 WP_000427822.1.62144 WP_000427822.1.62199 WP_000427822.1.62201 WP_000427822.1.62210 WP_000427822.1.62222 WP_000427822.1.62223 WP_000427822.1.62245 WP_000427822.1.62302 WP_000427822.1.62310 WP_000427822.1.62314 WP_000427822.1.62323 WP_000427822.1.62333 WP_000427822.1.62338 WP_000427822.1.62361 WP_000427822.1.62380 WP_000427822.1.62411 WP_000427822.1.62436 WP_000427822.1.62475 WP_000427822.1.62486 WP_000427822.1.62536 WP_000427822.1.62564 WP_000427822.1.62619 WP_000427822.1.62640 WP_000427822.1.62648 WP_000427822.1.62677 WP_000427822.1.62686 WP_000427822.1.62693 WP_000427822.1.627 WP_000427822.1.62725 WP_000427822.1.62751 WP_000427822.1.62825 WP_000427822.1.62828 WP_000427822.1.62913 WP_000427822.1.62932 WP_000427822.1.62960 WP_000427822.1.62983 WP_000427822.1.62988 WP_000427822.1.63016 WP_000427822.1.63025 WP_000427822.1.63043 WP_000427822.1.63045 WP_000427822.1.63069 WP_000427822.1.63087 WP_000427822.1.63102 WP_000427822.1.63155 WP_000427822.1.63169 WP_000427822.1.63229 WP_000427822.1.63234 WP_000427822.1.63243 WP_000427822.1.63297 WP_000427822.1.63358 WP_000427822.1.63422 WP_000427822.1.63448 WP_000427822.1.63499 WP_000427822.1.63509 WP_000427822.1.63514 WP_000427822.1.63529 WP_000427822.1.63568 WP_000427822.1.63583 WP_000427822.1.63585 WP_000427822.1.63592 WP_000427822.1.63663 WP_000427822.1.6367 WP_000427822.1.63690 WP_000427822.1.6370 WP_000427822.1.63736 WP_000427822.1.63748 WP_000427822.1.63766 WP_000427822.1.63781 WP_000427822.1.63782 WP_000427822.1.63816 WP_000427822.1.63824 WP_000427822.1.63831 WP_000427822.1.63851 WP_000427822.1.63860 WP_000427822.1.63864 WP_000427822.1.63866 WP_000427822.1.63876 WP_000427822.1.6389 WP_000427822.1.63901 WP_000427822.1.63903 WP_000427822.1.63912 WP_000427822.1.63934 WP_000427822.1.63955 WP_000427822.1.63958 WP_000427822.1.63963 WP_000427822.1.63977 WP_000427822.1.63992 WP_000427822.1.64007 WP_000427822.1.64010 WP_000427822.1.64032 WP_000427822.1.64085 WP_000427822.1.64087 WP_000427822.1.64109 WP_000427822.1.64121 WP_000427822.1.6415 WP_000427822.1.64208 WP_000427822.1.64242 WP_000427822.1.64266 WP_000427822.1.64293 WP_000427822.1.64294 WP_000427822.1.64332 WP_000427822.1.64350 WP_000427822.1.6437 WP_000427822.1.64376 WP_000427822.1.644 WP_000427822.1.64412 WP_000427822.1.64462 WP_000427822.1.64471 WP_000427822.1.64501 WP_000427822.1.6451 WP_000427822.1.64538 WP_000427822.1.64569 WP_000427822.1.64597 WP_000427822.1.64632 WP_000427822.1.64645 WP_000427822.1.64648 WP_000427822.1.64654 WP_000427822.1.64662 WP_000427822.1.64663 WP_000427822.1.64667 WP_000427822.1.64709 WP_000427822.1.64710 WP_000427822.1.64744 WP_000427822.1.64763 WP_000427822.1.64798 WP_000427822.1.64817 WP_000427822.1.64847 WP_000427822.1.6487 WP_000427822.1.64891 WP_000427822.1.64919 WP_000427822.1.64974 WP_000427822.1.64977 WP_000427822.1.65011 WP_000427822.1.65016 WP_000427822.1.65027 WP_000427822.1.65054 WP_000427822.1.65075 WP_000427822.1.6514 WP_000427822.1.65168 WP_000427822.1.65172 WP_000427822.1.65200 WP_000427822.1.65211 WP_000427822.1.65218 WP_000427822.1.65226 WP_000427822.1.65238 WP_000427822.1.65249 WP_000427822.1.65266 WP_000427822.1.65357 WP_000427822.1.65395 WP_000427822.1.65459 WP_000427822.1.65463 WP_000427822.1.65487 WP_000427822.1.6549 WP_000427822.1.65499 WP_000427822.1.6554 WP_000427822.1.65601 WP_000427822.1.6561 WP_000427822.1.65697 WP_000427822.1.65698 WP_000427822.1.65699 WP_000427822.1.6572 WP_000427822.1.65737 WP_000427822.1.65755 WP_000427822.1.65771 WP_000427822.1.65790 WP_000427822.1.65795 WP_000427822.1.65812 WP_000427822.1.65838 WP_000427822.1.65846 WP_000427822.1.65849 WP_000427822.1.65863 WP_000427822.1.65883 WP_000427822.1.65901 WP_000427822.1.6594 WP_000427822.1.6595 WP_000427822.1.65968 WP_000427822.1.65985 WP_000427822.1.66021 WP_000427822.1.66031 WP_000427822.1.66052 WP_000427822.1.66064 WP_000427822.1.66109 WP_000427822.1.66122 WP_000427822.1.66129 WP_000427822.1.66145 WP_000427822.1.66167 WP_000427822.1.66171 WP_000427822.1.66183 WP_000427822.1.66216 WP_000427822.1.66234 WP_000427822.1.66272 WP_000427822.1.66289 WP_000427822.1.66315 WP_000427822.1.66324 WP_000427822.1.6634 WP_000427822.1.66361 WP_000427822.1.66365 WP_000427822.1.66385 WP_000427822.1.66480 WP_000427822.1.66506 WP_000427822.1.66534 WP_000427822.1.66539 WP_000427822.1.66665 WP_000427822.1.66681 WP_000427822.1.66684 WP_000427822.1.66733 WP_000427822.1.66755 WP_000427822.1.66759 WP_000427822.1.66779 WP_000427822.1.66801 WP_000427822.1.66824 WP_000427822.1.66860 WP_000427822.1.66876 WP_000427822.1.6692 WP_000427822.1.66937 WP_000427822.1.66953 WP_000427822.1.66955 WP_000427822.1.66959 WP_000427822.1.66981 WP_000427822.1.67024 WP_000427822.1.67042 WP_000427822.1.67101 WP_000427822.1.67143 WP_000427822.1.67173 WP_000427822.1.67175 WP_000427822.1.67184 WP_000427822.1.67201 WP_000427822.1.67211 WP_000427822.1.67237 WP_000427822.1.67279 WP_000427822.1.67288 WP_000427822.1.67336 WP_000427822.1.67374 WP_000427822.1.67387 WP_000427822.1.67394 WP_000427822.1.67397 WP_000427822.1.67403 WP_000427822.1.67405 WP_000427822.1.67430 WP_000427822.1.67442 WP_000427822.1.67539 WP_000427822.1.67556 WP_000427822.1.67576 WP_000427822.1.6760 WP_000427822.1.67604 WP_000427822.1.67619 WP_000427822.1.67627 WP_000427822.1.67641 WP_000427822.1.67657 WP_000427822.1.67700 WP_000427822.1.67707 WP_000427822.1.67729 WP_000427822.1.67772 WP_000427822.1.67774 WP_000427822.1.67814 WP_000427822.1.6782 WP_000427822.1.67820 WP_000427822.1.6785 WP_000427822.1.67905 WP_000427822.1.67924 WP_000427822.1.67932 WP_000427822.1.67954 WP_000427822.1.67969 WP_000427822.1.67977 WP_000427822.1.68 WP_000427822.1.68043 WP_000427822.1.68075 WP_000427822.1.68105 WP_000427822.1.68113 WP_000427822.1.68115 WP_000427822.1.68131 WP_000427822.1.68140 WP_000427822.1.68147 WP_000427822.1.68182 WP_000427822.1.6819 WP_000427822.1.68285 WP_000427822.1.68359 WP_000427822.1.68420 WP_000427822.1.685 WP_000427822.1.68514 WP_000427822.1.68532 WP_000427822.1.68564 WP_000427822.1.68652 WP_000427822.1.68677 WP_000427822.1.68688 WP_000427822.1.6869 WP_000427822.1.68690 WP_000427822.1.68742 WP_000427822.1.6875 WP_000427822.1.68770 WP_000427822.1.6879 WP_000427822.1.68809 WP_000427822.1.68818 WP_000427822.1.6882 WP_000427822.1.68893 WP_000427822.1.68895 WP_000427822.1.68914 WP_000427822.1.68958 WP_000427822.1.69053 WP_000427822.1.6907 WP_000427822.1.69086 WP_000427822.1.69131 WP_000427822.1.69170 WP_000427822.1.69210 WP_000427822.1.69236 WP_000427822.1.69270 WP_000427822.1.69273 WP_000427822.1.69282 WP_000427822.1.69288 WP_000427822.1.69320 WP_000427822.1.69346 WP_000427822.1.69357 WP_000427822.1.69371 WP_000427822.1.69376 WP_000427822.1.69396 WP_000427822.1.69466 WP_000427822.1.69515 WP_000427822.1.69554 WP_000427822.1.69575 WP_000427822.1.69588 WP_000427822.1.69592 WP_000427822.1.69597 WP_000427822.1.69611 WP_000427822.1.69616 WP_000427822.1.69636 WP_000427822.1.69642 WP_000427822.1.69656 WP_000427822.1.69657 WP_000427822.1.69690 WP_000427822.1.69696 WP_000427822.1.69754 WP_000427822.1.69767 WP_000427822.1.69785 WP_000427822.1.69790 WP_000427822.1.69807 WP_000427822.1.69817 WP_000427822.1.69890 WP_000427822.1.69923 WP_000427822.1.69948 WP_000427822.1.69953 WP_000427822.1.69965 WP_000427822.1.69982 WP_000427822.1.70003 WP_000427822.1.70010 WP_000427822.1.70049 WP_000427822.1.70058 WP_000427822.1.70061 WP_000427822.1.70088 WP_000427822.1.7010 WP_000427822.1.7014 WP_000427822.1.7016 WP_000427822.1.70169 WP_000427822.1.70183 WP_000427822.1.70205 WP_000427822.1.70240 WP_000427822.1.70248 WP_000427822.1.70249 WP_000427822.1.70261 WP_000427822.1.70272 WP_000427822.1.70281 WP_000427822.1.70303 WP_000427822.1.70314 WP_000427822.1.70321 WP_000427822.1.70326 WP_000427822.1.70327 WP_000427822.1.7033 WP_000427822.1.70355 WP_000427822.1.70427 WP_000427822.1.70433 WP_000427822.1.7044 WP_000427822.1.70440 WP_000427822.1.70523 WP_000427822.1.70545 WP_000427822.1.70547 WP_000427822.1.70596 WP_000427822.1.70623 WP_000427822.1.70671 WP_000427822.1.70678 WP_000427822.1.70679 WP_000427822.1.70685 WP_000427822.1.70708 WP_000427822.1.70717 WP_000427822.1.70731 WP_000427822.1.70732 WP_000427822.1.70733 WP_000427822.1.70761 WP_000427822.1.70772 WP_000427822.1.70797 WP_000427822.1.70837 WP_000427822.1.70845 WP_000427822.1.70869 WP_000427822.1.70899 WP_000427822.1.70914 WP_000427822.1.70929 WP_000427822.1.7093 WP_000427822.1.70977 WP_000427822.1.70981 WP_000427822.1.70986 WP_000427822.1.71007 WP_000427822.1.71010 WP_000427822.1.71039 WP_000427822.1.71057 WP_000427822.1.71069 WP_000427822.1.71081 WP_000427822.1.7110 WP_000427822.1.71117 WP_000427822.1.71120 WP_000427822.1.71171 WP_000427822.1.71172 WP_000427822.1.71184 WP_000427822.1.71186 WP_000427822.1.71201 WP_000427822.1.71248 WP_000427822.1.71268 WP_000427822.1.7134 WP_000427822.1.714 WP_000427822.1.71407 WP_000427822.1.71418 WP_000427822.1.7142 WP_000427822.1.71446 WP_000427822.1.71450 WP_000427822.1.71455 WP_000427822.1.71456 WP_000427822.1.71487 WP_000427822.1.71523 WP_000427822.1.71542 WP_000427822.1.71566 WP_000427822.1.71583 WP_000427822.1.71600 WP_000427822.1.71640 WP_000427822.1.71651 WP_000427822.1.71653 WP_000427822.1.71716 WP_000427822.1.7174 WP_000427822.1.71746 WP_000427822.1.71756 WP_000427822.1.71872 WP_000427822.1.71929 WP_000427822.1.71941 WP_000427822.1.71950 WP_000427822.1.71954 WP_000427822.1.71979 WP_000427822.1.71984 WP_000427822.1.71985 WP_000427822.1.72003 WP_000427822.1.72065 WP_000427822.1.72073 WP_000427822.1.72100 WP_000427822.1.72107 WP_000427822.1.72182 WP_000427822.1.72188 WP_000427822.1.72190 WP_000427822.1.72221 WP_000427822.1.72226 WP_000427822.1.72243 WP_000427822.1.72269 WP_000427822.1.72277 WP_000427822.1.72281 WP_000427822.1.72300 WP_000427822.1.72350 WP_000427822.1.72351 WP_000427822.1.72382 WP_000427822.1.72383 WP_000427822.1.72461 WP_000427822.1.72470 WP_000427822.1.72527 WP_000427822.1.72532 WP_000427822.1.7255 WP_000427822.1.72602 WP_000427822.1.72625 WP_000427822.1.72631 WP_000427822.1.72638 WP_000427822.1.72667 WP_000427822.1.72674 WP_000427822.1.72689 WP_000427822.1.72716 WP_000427822.1.72718 WP_000427822.1.72724 WP_000427822.1.72789 WP_000427822.1.72793 WP_000427822.1.72843 WP_000427822.1.72865 WP_000427822.1.72872 WP_000427822.1.72887 WP_000427822.1.72892 WP_000427822.1.72894 WP_000427822.1.72896 WP_000427822.1.72968 WP_000427822.1.72969 WP_000427822.1.72987 WP_000427822.1.73052 WP_000427822.1.7311 WP_000427822.1.73114 WP_000427822.1.73144 WP_000427822.1.7316 WP_000427822.1.73164 WP_000427822.1.73177 WP_000427822.1.73180 WP_000427822.1.73258 WP_000427822.1.73285 WP_000427822.1.7332 WP_000427822.1.7333 WP_000427822.1.73352 WP_000427822.1.73389 WP_000427822.1.73425 WP_000427822.1.73488 WP_000427822.1.73504 WP_000427822.1.7353 WP_000427822.1.73544 WP_000427822.1.73596 WP_000427822.1.73598 WP_000427822.1.7361 WP_000427822.1.73648 WP_000427822.1.73708 WP_000427822.1.73764 WP_000427822.1.73768 WP_000427822.1.73831 WP_000427822.1.73849 WP_000427822.1.7386 WP_000427822.1.73901 WP_000427822.1.7394 WP_000427822.1.73945 WP_000427822.1.73948 WP_000427822.1.73999 WP_000427822.1.74024 WP_000427822.1.74030 WP_000427822.1.74038 WP_000427822.1.74040 WP_000427822.1.74043 WP_000427822.1.74058 WP_000427822.1.74070 WP_000427822.1.74077 WP_000427822.1.74117 WP_000427822.1.74135 WP_000427822.1.74174 WP_000427822.1.74214 WP_000427822.1.74241 WP_000427822.1.74285 WP_000427822.1.743 WP_000427822.1.7430 WP_000427822.1.74300 WP_000427822.1.74317 WP_000427822.1.74402 WP_000427822.1.74415 WP_000427822.1.74418 WP_000427822.1.74422 WP_000427822.1.74428 WP_000427822.1.74454 WP_000427822.1.74469 WP_000427822.1.74500 WP_000427822.1.74570 WP_000427822.1.74578 WP_000427822.1.7458 WP_000427822.1.74616 WP_000427822.1.74620 WP_000427822.1.74621 WP_000427822.1.74639 WP_000427822.1.74644 WP_000427822.1.74647 WP_000427822.1.74677 WP_000427822.1.74702 WP_000427822.1.74806 WP_000427822.1.74831 WP_000427822.1.74876 WP_000427822.1.74884 WP_000427822.1.74894 WP_000427822.1.74929 WP_000427822.1.74939 WP_000427822.1.74972 WP_000427822.1.74973 WP_000427822.1.74992 WP_000427822.1.74996 WP_000427822.1.75051 WP_000427822.1.75056 WP_000427822.1.7507 WP_000427822.1.75089 WP_000427822.1.75114 WP_000427822.1.75116 WP_000427822.1.75159 WP_000427822.1.75168 WP_000427822.1.75180 WP_000427822.1.75237 WP_000427822.1.75273 WP_000427822.1.75296 WP_000427822.1.75301 WP_000427822.1.7531 WP_000427822.1.75400 WP_000427822.1.75402 WP_000427822.1.75413 WP_000427822.1.75433 WP_000427822.1.75450 WP_000427822.1.75532 WP_000427822.1.75565 WP_000427822.1.7558 WP_000427822.1.75593 WP_000427822.1.75607 WP_000427822.1.75610 WP_000427822.1.75633 WP_000427822.1.75664 WP_000427822.1.75703 WP_000427822.1.75716 WP_000427822.1.75718 WP_000427822.1.75740 WP_000427822.1.75745 WP_000427822.1.75751 WP_000427822.1.75793 WP_000427822.1.75794 WP_000427822.1.75844 WP_000427822.1.75873 WP_000427822.1.75886 WP_000427822.1.75898 WP_000427822.1.75957 WP_000427822.1.76055 WP_000427822.1.76081 WP_000427822.1.76097 WP_000427822.1.76108 WP_000427822.1.76116 WP_000427822.1.76122 WP_000427822.1.76156 WP_000427822.1.76162 WP_000427822.1.76186 WP_000427822.1.76197 WP_000427822.1.76208 WP_000427822.1.76256 WP_000427822.1.7629 WP_000427822.1.76301 WP_000427822.1.76339 WP_000427822.1.76345 WP_000427822.1.76364 WP_000427822.1.76366 WP_000427822.1.76417 WP_000427822.1.7646 WP_000427822.1.76471 WP_000427822.1.76510 WP_000427822.1.76532 WP_000427822.1.76558 WP_000427822.1.76572 WP_000427822.1.76611 WP_000427822.1.76641 WP_000427822.1.76651 WP_000427822.1.76653 WP_000427822.1.7672 WP_000427822.1.76724 WP_000427822.1.76738 WP_000427822.1.76776 WP_000427822.1.76788 WP_000427822.1.76799 WP_000427822.1.76806 WP_000427822.1.7684 WP_000427822.1.76854 WP_000427822.1.76913 WP_000427822.1.76916 WP_000427822.1.76932 WP_000427822.1.76968 WP_000427822.1.76973 WP_000427822.1.76988 WP_000427822.1.77016 WP_000427822.1.77033 WP_000427822.1.77067 WP_000427822.1.77087 WP_000427822.1.77090 WP_000427822.1.77111 WP_000427822.1.77184 WP_000427822.1.77193 WP_000427822.1.77241 WP_000427822.1.77271 WP_000427822.1.77299 WP_000427822.1.77306 WP_000427822.1.77356 WP_000427822.1.77384 WP_000427822.1.77436 WP_000427822.1.77475 WP_000427822.1.77501 WP_000427822.1.77512 WP_000427822.1.77513 WP_000427822.1.77543 WP_000427822.1.77555 WP_000427822.1.77563 WP_000427822.1.77565 WP_000427822.1.77596 WP_000427822.1.77653 WP_000427822.1.77702 WP_000427822.1.77713 WP_000427822.1.7772 WP_000427822.1.77729 WP_000427822.1.77754 WP_000427822.1.77825 WP_000427822.1.77837 WP_000427822.1.77900 WP_000427822.1.7792 WP_000427822.1.77923 WP_000427822.1.7793 WP_000427822.1.77975 WP_000427822.1.77989 WP_000427822.1.7802 WP_000427822.1.78026 WP_000427822.1.78035 WP_000427822.1.78048 WP_000427822.1.78051 WP_000427822.1.78107 WP_000427822.1.7814 WP_000427822.1.78166 WP_000427822.1.78170 WP_000427822.1.78192 WP_000427822.1.78195 WP_000427822.1.78201 WP_000427822.1.78245 WP_000427822.1.78291 WP_000427822.1.78309 WP_000427822.1.78320 WP_000427822.1.78388 WP_000427822.1.78410 WP_000427822.1.78495 WP_000427822.1.78496 WP_000427822.1.78501 WP_000427822.1.78502 WP_000427822.1.78602 WP_000427822.1.78603 WP_000427822.1.7862 WP_000427822.1.78626 WP_000427822.1.78658 WP_000427822.1.78661 WP_000427822.1.78674 WP_000427822.1.78676 WP_000427822.1.78697 WP_000427822.1.78761 WP_000427822.1.7877 WP_000427822.1.78771 WP_000427822.1.78789 WP_000427822.1.78815 WP_000427822.1.78862 WP_000427822.1.78881 WP_000427822.1.78896 WP_000427822.1.789 WP_000427822.1.7891 WP_000427822.1.78913 WP_000427822.1.78928 WP_000427822.1.78951 WP_000427822.1.78993 WP_000427822.1.79011 WP_000427822.1.79012 WP_000427822.1.79032 WP_000427822.1.79069 WP_000427822.1.79074 WP_000427822.1.79098 WP_000427822.1.79099 WP_000427822.1.79140 WP_000427822.1.79155 WP_000427822.1.79164 WP_000427822.1.79203 WP_000427822.1.79204 WP_000427822.1.79280 WP_000427822.1.79297 WP_000427822.1.79302 WP_000427822.1.79370 WP_000427822.1.79397 WP_000427822.1.79427 WP_000427822.1.79456 WP_000427822.1.79466 WP_000427822.1.79532 WP_000427822.1.79547 WP_000427822.1.79580 WP_000427822.1.79586 WP_000427822.1.79645 WP_000427822.1.79654 WP_000427822.1.7970 WP_000427822.1.7972 WP_000427822.1.79722 WP_000427822.1.79757 WP_000427822.1.79772 WP_000427822.1.7979 WP_000427822.1.7982 WP_000427822.1.79832 WP_000427822.1.79867 WP_000427822.1.79880 WP_000427822.1.7991 WP_000427822.1.79910 WP_000427822.1.79914 WP_000427822.1.79916 WP_000427822.1.79934 WP_000427822.1.79942 WP_000427822.1.79951 WP_000427822.1.79966 WP_000427822.1.79974 WP_000427822.1.80103 WP_000427822.1.80236 WP_000427822.1.8024 WP_000427822.1.80249 WP_000427822.1.80250 WP_000427822.1.80273 WP_000427822.1.80282 WP_000427822.1.80307 WP_000427822.1.80354 WP_000427822.1.80368 WP_000427822.1.80386 WP_000427822.1.80400 WP_000427822.1.80441 WP_000427822.1.80443 WP_000427822.1.80462 WP_000427822.1.80473 WP_000427822.1.80479 WP_000427822.1.80480 WP_000427822.1.8049 WP_000427822.1.80492 WP_000427822.1.80496 WP_000427822.1.80529 WP_000427822.1.80542 WP_000427822.1.80569 WP_000427822.1.80586 WP_000427822.1.80609 WP_000427822.1.80629 WP_000427822.1.80664 WP_000427822.1.80667 WP_000427822.1.80674 WP_000427822.1.80696 WP_000427822.1.80725 WP_000427822.1.80750 WP_000427822.1.80760 WP_000427822.1.80827 WP_000427822.1.80857 WP_000427822.1.80868 WP_000427822.1.80874 WP_000427822.1.80876 WP_000427822.1.80959 WP_000427822.1.80973 WP_000427822.1.80984 WP_000427822.1.8106 WP_000427822.1.81107 WP_000427822.1.81118 WP_000427822.1.81131 WP_000427822.1.81187 WP_000427822.1.81225 WP_000427822.1.81262 WP_000427822.1.81268 WP_000427822.1.81269 WP_000427822.1.81271 WP_000427822.1.81275 WP_000427822.1.8130 WP_000427822.1.81302 WP_000427822.1.8131 WP_000427822.1.81321 WP_000427822.1.81333 WP_000427822.1.8134 WP_000427822.1.81342 WP_000427822.1.81364 WP_000427822.1.81388 WP_000427822.1.81455 WP_000427822.1.81494 WP_000427822.1.81557 WP_000427822.1.81667 WP_000427822.1.81668 WP_000427822.1.81676 WP_000427822.1.81681 WP_000427822.1.8170 WP_000427822.1.81727 WP_000427822.1.81736 WP_000427822.1.81763 WP_000427822.1.81795 WP_000427822.1.81855 WP_000427822.1.81921 WP_000427822.1.81931 WP_000427822.1.81936 WP_000427822.1.81949 WP_000427822.1.81977 WP_000427822.1.82037 WP_000427822.1.82070 WP_000427822.1.82076 WP_000427822.1.82099 WP_000427822.1.82131 WP_000427822.1.82141 WP_000427822.1.82144 WP_000427822.1.82149 WP_000427822.1.82156 WP_000427822.1.8218 WP_000427822.1.82180 WP_000427822.1.82201 WP_000427822.1.82214 WP_000427822.1.82225 WP_000427822.1.82395 WP_000427822.1.8240 WP_000427822.1.82401 WP_000427822.1.82408 WP_000427822.1.82416 WP_000427822.1.8242 WP_000427822.1.82420 WP_000427822.1.82434 WP_000427822.1.82456 WP_000427822.1.82465 WP_000427822.1.8247 WP_000427822.1.82473 WP_000427822.1.82530 WP_000427822.1.82553 WP_000427822.1.82570 WP_000427822.1.82584 WP_000427822.1.82646 WP_000427822.1.82648 WP_000427822.1.82670 WP_000427822.1.82731 WP_000427822.1.82812 WP_000427822.1.82841 WP_000427822.1.82850 WP_000427822.1.82872 WP_000427822.1.82895 WP_000427822.1.82959 WP_000427822.1.82992 WP_000427822.1.83005 WP_000427822.1.83006 WP_000427822.1.83007 WP_000427822.1.8304 WP_000427822.1.83061 WP_000427822.1.83119 WP_000427822.1.83128 WP_000427822.1.83180 WP_000427822.1.83204 WP_000427822.1.8322 WP_000427822.1.83229 WP_000427822.1.83235 WP_000427822.1.83258 WP_000427822.1.83290 WP_000427822.1.83331 WP_000427822.1.83333 WP_000427822.1.83356 WP_000427822.1.83360 WP_000427822.1.83407 WP_000427822.1.83516 WP_000427822.1.83558 WP_000427822.1.83650 WP_000427822.1.83657 WP_000427822.1.83677 WP_000427822.1.83710 WP_000427822.1.83759 WP_000427822.1.83854 WP_000427822.1.83897 WP_000427822.1.83923 WP_000427822.1.83960 WP_000427822.1.83979 WP_000427822.1.83994 WP_000427822.1.84 WP_000427822.1.84000 WP_000427822.1.84001 WP_000427822.1.84011 WP_000427822.1.8406 WP_000427822.1.84076 WP_000427822.1.84077 WP_000427822.1.84086 WP_000427822.1.84100 WP_000427822.1.84106 WP_000427822.1.84110 WP_000427822.1.84115 WP_000427822.1.84127 WP_000427822.1.84150 WP_000427822.1.84154 WP_000427822.1.84205 WP_000427822.1.84209 WP_000427822.1.84230 WP_000427822.1.8425 WP_000427822.1.84252 WP_000427822.1.8431 WP_000427822.1.84345 WP_000427822.1.84355 WP_000427822.1.84369 WP_000427822.1.84401 WP_000427822.1.84403 WP_000427822.1.84435 WP_000427822.1.84475 WP_000427822.1.84515 WP_000427822.1.84551 WP_000427822.1.84567 WP_000427822.1.84572 WP_000427822.1.84598 WP_000427822.1.84631 WP_000427822.1.84683 WP_000427822.1.84711 WP_000427822.1.84727 WP_000427822.1.84744 WP_000427822.1.84745 WP_000427822.1.84773 WP_000427822.1.84876 WP_000427822.1.84945 WP_000427822.1.84967 WP_000427822.1.84983 WP_000427822.1.85004 WP_000427822.1.8502 WP_000427822.1.85039 WP_000427822.1.85079 WP_000427822.1.85120 WP_000427822.1.85126 WP_000427822.1.85153 WP_000427822.1.85192 WP_000427822.1.85217 WP_000427822.1.8526 WP_000427822.1.85273 WP_000427822.1.85301 WP_000427822.1.85338 WP_000427822.1.85339 WP_000427822.1.85408 WP_000427822.1.85469 WP_000427822.1.85511 WP_000427822.1.8552 WP_000427822.1.8557 WP_000427822.1.85606 WP_000427822.1.85635 WP_000427822.1.85646 WP_000427822.1.85665 WP_000427822.1.85669 WP_000427822.1.85688 WP_000427822.1.85703 WP_000427822.1.85723 WP_000427822.1.85728 WP_000427822.1.85742 WP_000427822.1.85746 WP_000427822.1.85759 WP_000427822.1.85784 WP_000427822.1.85797 WP_000427822.1.85811 WP_000427822.1.859 WP_000427822.1.8591 WP_000427822.1.85917 WP_000427822.1.8594 WP_000427822.1.85943 WP_000427822.1.85977 WP_000427822.1.85982 WP_000427822.1.860 WP_000427822.1.86010 WP_000427822.1.8605 WP_000427822.1.86084 WP_000427822.1.86092 WP_000427822.1.8610 WP_000427822.1.86126 WP_000427822.1.86138 WP_000427822.1.8614 WP_000427822.1.86156 WP_000427822.1.86159 WP_000427822.1.8616 WP_000427822.1.86240 WP_000427822.1.86259 WP_000427822.1.86284 WP_000427822.1.86285 WP_000427822.1.86310 WP_000427822.1.86316 WP_000427822.1.86323 WP_000427822.1.86335 WP_000427822.1.86342 WP_000427822.1.86347 WP_000427822.1.86380 WP_000427822.1.8640 WP_000427822.1.8642 WP_000427822.1.86426 WP_000427822.1.86453 WP_000427822.1.8647 WP_000427822.1.86489 WP_000427822.1.86530 WP_000427822.1.86601 WP_000427822.1.86610 WP_000427822.1.86656 WP_000427822.1.86658 WP_000427822.1.86663 WP_000427822.1.86770 WP_000427822.1.86794 WP_000427822.1.86800 WP_000427822.1.86807 WP_000427822.1.86811 WP_000427822.1.86815 WP_000427822.1.86860 WP_000427822.1.8691 WP_000427822.1.86915 WP_000427822.1.86989 WP_000427822.1.87023 WP_000427822.1.87034 WP_000427822.1.87051 WP_000427822.1.87136 WP_000427822.1.87148 WP_000427822.1.87155 WP_000427822.1.87187 WP_000427822.1.87219 WP_000427822.1.8722 WP_000427822.1.87258 WP_000427822.1.87265 WP_000427822.1.87282 WP_000427822.1.87420 WP_000427822.1.87500 WP_000427822.1.87528 WP_000427822.1.87560 WP_000427822.1.87583 WP_000427822.1.8760 WP_000427822.1.87600 WP_000427822.1.87609 WP_000427822.1.87612 WP_000427822.1.87615 WP_000427822.1.87618 WP_000427822.1.87653 WP_000427822.1.87659 WP_000427822.1.87687 WP_000427822.1.87698 WP_000427822.1.87706 WP_000427822.1.87741 WP_000427822.1.87742 WP_000427822.1.87760 WP_000427822.1.87852 WP_000427822.1.87875 WP_000427822.1.87905 WP_000427822.1.87933 WP_000427822.1.87936 WP_000427822.1.87949 WP_000427822.1.87999 WP_000427822.1.88014 WP_000427822.1.88025 WP_000427822.1.88026 WP_000427822.1.8805 WP_000427822.1.8806 WP_000427822.1.881 WP_000427822.1.88136 WP_000427822.1.88145 WP_000427822.1.88199 WP_000427822.1.88214 WP_000427822.1.88275 WP_000427822.1.88299 WP_000427822.1.88303 WP_000427822.1.88313 WP_000427822.1.88356 WP_000427822.1.88407 WP_000427822.1.88414 WP_000427822.1.88444 WP_000427822.1.88446 WP_000427822.1.88458 WP_000427822.1.88474 WP_000427822.1.88501 WP_000427822.1.88508 WP_000427822.1.88538 WP_000427822.1.88547 WP_000427822.1.88597 WP_000427822.1.886 WP_000427822.1.88609 WP_000427822.1.88647 WP_000427822.1.88648 WP_000427822.1.88651 WP_000427822.1.88675 WP_000427822.1.88683 WP_000427822.1.88692 WP_000427822.1.88698 WP_000427822.1.88707 WP_000427822.1.88727 WP_000427822.1.88731 WP_000427822.1.88762 WP_000427822.1.88772 WP_000427822.1.88845 WP_000427822.1.88850 WP_000427822.1.88854 WP_000427822.1.88892 WP_000427822.1.88894 WP_000427822.1.88967 WP_000427822.1.88970 WP_000427822.1.88982 WP_000427822.1.88998 WP_000427822.1.89120 WP_000427822.1.89177 WP_000427822.1.89182 WP_000427822.1.89298 WP_000427822.1.89308 WP_000427822.1.89311 WP_000427822.1.89314 WP_000427822.1.89328 WP_000427822.1.89332 WP_000427822.1.89343 WP_000427822.1.89362 WP_000427822.1.89395 WP_000427822.1.8940 WP_000427822.1.89408 WP_000427822.1.89449 WP_000427822.1.89452 WP_000427822.1.89462 WP_000427822.1.8947 WP_000427822.1.89503 WP_000427822.1.8958 WP_000427822.1.89591 WP_000427822.1.89606 WP_000427822.1.8961 WP_000427822.1.89612 WP_000427822.1.89632 WP_000427822.1.89634 WP_000427822.1.89668 WP_000427822.1.89706 WP_000427822.1.89713 WP_000427822.1.89733 WP_000427822.1.89746 WP_000427822.1.89796 WP_000427822.1.89804 WP_000427822.1.89832 WP_000427822.1.89845 WP_000427822.1.89888 WP_000427822.1.89911 WP_000427822.1.89940 WP_000427822.1.8995 WP_000427822.1.89965 WP_000427822.1.90007 WP_000427822.1.9011 WP_000427822.1.90193 WP_000427822.1.90196 WP_000427822.1.90211 WP_000427822.1.90220 WP_000427822.1.90240 WP_000427822.1.90274 WP_000427822.1.90280 WP_000427822.1.90330 WP_000427822.1.90338 WP_000427822.1.90348 WP_000427822.1.90365 WP_000427822.1.90428 WP_000427822.1.90440 WP_000427822.1.90472 WP_000427822.1.90489 WP_000427822.1.90513 WP_000427822.1.90521 WP_000427822.1.90522 WP_000427822.1.90563 WP_000427822.1.90582 WP_000427822.1.90620 WP_000427822.1.9064 WP_000427822.1.90686 WP_000427822.1.90701 WP_000427822.1.90713 WP_000427822.1.90748 WP_000427822.1.90759 WP_000427822.1.90794 WP_000427822.1.90796 WP_000427822.1.90811 WP_000427822.1.90859 WP_000427822.1.90866 WP_000427822.1.9089 WP_000427822.1.9091 WP_000427822.1.90959 WP_000427822.1.90983 WP_000427822.1.91067 WP_000427822.1.91107 WP_000427822.1.91164 WP_000427822.1.91205 WP_000427822.1.91215 WP_000427822.1.91239 WP_000427822.1.91291 WP_000427822.1.91313 WP_000427822.1.91334 WP_000427822.1.9135 WP_000427822.1.9137 WP_000427822.1.91372 WP_000427822.1.91381 WP_000427822.1.91424 WP_000427822.1.91470 WP_000427822.1.91505 WP_000427822.1.91506 WP_000427822.1.91557 WP_000427822.1.91580 WP_000427822.1.91702 WP_000427822.1.91715 WP_000427822.1.91742 WP_000427822.1.91776 WP_000427822.1.91864 WP_000427822.1.9187 WP_000427822.1.91870 WP_000427822.1.91880 WP_000427822.1.91898 WP_000427822.1.91903 WP_000427822.1.91904 WP_000427822.1.91914 WP_000427822.1.92018 WP_000427822.1.92044 WP_000427822.1.92047 WP_000427822.1.92067 WP_000427822.1.92087 WP_000427822.1.92098 WP_000427822.1.92099 WP_000427822.1.92156 WP_000427822.1.92172 WP_000427822.1.9222 WP_000427822.1.92240 WP_000427822.1.92243 WP_000427822.1.92299 WP_000427822.1.92327 WP_000427822.1.92394 WP_000427822.1.92399 WP_000427822.1.92439 WP_000427822.1.92452 WP_000427822.1.92470 WP_000427822.1.92477 WP_000427822.1.92529 WP_000427822.1.9253 WP_000427822.1.92545 WP_000427822.1.92557 WP_000427822.1.92562 WP_000427822.1.92570 WP_000427822.1.92588 WP_000427822.1.926 WP_000427822.1.92628 WP_000427822.1.92633 WP_000427822.1.92649 WP_000427822.1.92659 WP_000427822.1.92676 WP_000427822.1.92705 WP_000427822.1.9271 WP_000427822.1.92729 WP_000427822.1.92734 WP_000427822.1.92754 WP_000427822.1.92758 WP_000427822.1.92806 WP_000427822.1.92810 WP_000427822.1.92823 WP_000427822.1.92827 WP_000427822.1.92836 WP_000427822.1.92843 WP_000427822.1.92875 WP_000427822.1.92890 WP_000427822.1.92895 WP_000427822.1.92939 WP_000427822.1.92975 WP_000427822.1.92987 WP_000427822.1.93007 WP_000427822.1.93022 WP_000427822.1.93061 WP_000427822.1.93103 WP_000427822.1.93105 WP_000427822.1.93111 WP_000427822.1.93121 WP_000427822.1.93168 WP_000427822.1.93213 WP_000427822.1.93215 WP_000427822.1.93221 WP_000427822.1.93223 WP_000427822.1.93239 WP_000427822.1.93302 WP_000427822.1.93350 WP_000427822.1.9336 WP_000427822.1.93387 WP_000427822.1.93410 WP_000427822.1.93469 WP_000427822.1.93511 WP_000427822.1.93512 WP_000427822.1.93524 WP_000427822.1.93577 WP_000427822.1.93596 WP_000427822.1.93635 WP_000427822.1.93657 WP_000427822.1.93691 WP_000427822.1.9374 WP_000427822.1.93741 WP_000427822.1.9375 WP_000427822.1.93754 WP_000427822.1.93761 WP_000427822.1.93780 WP_000427822.1.9380 WP_000427822.1.93828 WP_000427822.1.93842 WP_000427822.1.93843 WP_000427822.1.93875 WP_000427822.1.93909 WP_000427822.1.93919 WP_000427822.1.93984 WP_000427822.1.93986 WP_000427822.1.9399 WP_000427822.1.94017 WP_000427822.1.94039 WP_000427822.1.94056 WP_000427822.1.94064 WP_000427822.1.94079 WP_000427822.1.94097 WP_000427822.1.94107 WP_000427822.1.94142 WP_000427822.1.94167 WP_000427822.1.94181 WP_000427822.1.94215 WP_000427822.1.94303 WP_000427822.1.94352 WP_000427822.1.94365 WP_000427822.1.94379 WP_000427822.1.94390 WP_000427822.1.94412 WP_000427822.1.94415 WP_000427822.1.94473 WP_000427822.1.94492 WP_000427822.1.94510 WP_000427822.1.94527 WP_000427822.1.94562 WP_000427822.1.94573 WP_000427822.1.94579 WP_000427822.1.94586 WP_000427822.1.94588 WP_000427822.1.94593 WP_000427822.1.94598 WP_000427822.1.94649 WP_000427822.1.94650 WP_000427822.1.94659 WP_000427822.1.94662 WP_000427822.1.94669 WP_000427822.1.94700 WP_000427822.1.94717 WP_000427822.1.94722 WP_000427822.1.94745 WP_000427822.1.94782 WP_000427822.1.94785 WP_000427822.1.94815 WP_000427822.1.94817 WP_000427822.1.94820 WP_000427822.1.94835 WP_000427822.1.94849 WP_000427822.1.94850 WP_000427822.1.94851 WP_000427822.1.94862 WP_000427822.1.94864 WP_000427822.1.94947 WP_000427822.1.94952 WP_000427822.1.94982 WP_000427822.1.94983 WP_000427822.1.94986 WP_000427822.1.95006 WP_000427822.1.9503 WP_000427822.1.95055 WP_000427822.1.95076 WP_000427822.1.95099 WP_000427822.1.95136 WP_000427822.1.95165 WP_000427822.1.95171 WP_000427822.1.95239 WP_000427822.1.95246 WP_000427822.1.95249 WP_000427822.1.9525 WP_000427822.1.95255 WP_000427822.1.95265 WP_000427822.1.9527 WP_000427822.1.95289 WP_000427822.1.95298 WP_000427822.1.9530 WP_000427822.1.95320 WP_000427822.1.95338 WP_000427822.1.95412 WP_000427822.1.95434 WP_000427822.1.95530 WP_000427822.1.95547 WP_000427822.1.95558 WP_000427822.1.95579 WP_000427822.1.95590 WP_000427822.1.95623 WP_000427822.1.95625 WP_000427822.1.95675 WP_000427822.1.95716 WP_000427822.1.95729 WP_000427822.1.9574 WP_000427822.1.95744 WP_000427822.1.95776 WP_000427822.1.95840 WP_000427822.1.9586 WP_000427822.1.95866 WP_000427822.1.95884 WP_000427822.1.95890 WP_000427822.1.95906 WP_000427822.1.96025 WP_000427822.1.96042 WP_000427822.1.96044 WP_000427822.1.96045 WP_000427822.1.9609 WP_000427822.1.96094 WP_000427822.1.96127 WP_000427822.1.96144 WP_000427822.1.96188 WP_000427822.1.96190 WP_000427822.1.96206 WP_000427822.1.96211 WP_000427822.1.96212 WP_000427822.1.96319 WP_000427822.1.9633 WP_000427822.1.96335 WP_000427822.1.96340 WP_000427822.1.96359 WP_000427822.1.96380 WP_000427822.1.96490 WP_000427822.1.96521 WP_000427822.1.96533 WP_000427822.1.96537 WP_000427822.1.96539 WP_000427822.1.96552 WP_000427822.1.96584 WP_000427822.1.96588 WP_000427822.1.96600 WP_000427822.1.96610 WP_000427822.1.96625 WP_000427822.1.96635 WP_000427822.1.9664 WP_000427822.1.96642 WP_000427822.1.96675 WP_000427822.1.9670 WP_000427822.1.96735 WP_000427822.1.96750 WP_000427822.1.96758 WP_000427822.1.96761 WP_000427822.1.96792 WP_000427822.1.96798 WP_000427822.1.96801 WP_000427822.1.96803 WP_000427822.1.96810 WP_000427822.1.96876 WP_000427822.1.96925 WP_000427822.1.96938 WP_000427822.1.96946 WP_000427822.1.96957 WP_000427822.1.96978 WP_000427822.1.96993 WP_000427822.1.97005 WP_000427822.1.97026 WP_000427822.1.97028 WP_000427822.1.97043 WP_000427822.1.97103 WP_000427822.1.97154 WP_000427822.1.97184 WP_000427822.1.97224 WP_000427822.1.97287 WP_000427822.1.97291 WP_000427822.1.97322 WP_000427822.1.97368 WP_000427822.1.97422 WP_000427822.1.97441 WP_000427822.1.97480 WP_000427822.1.97496 WP_000427822.1.97497 WP_000427822.1.97505 WP_000427822.1.97599 WP_000427822.1.97606 WP_000427822.1.97615 WP_000427822.1.97626 WP_000427822.1.97646 WP_000427822.1.97648 WP_000427822.1.97690 WP_000427822.1.97691 WP_000427822.1.97704 WP_000427822.1.97725 WP_000427822.1.97800 WP_000427822.1.97819 WP_000427822.1.97840 WP_000427822.1.97873 WP_000427822.1.97907 WP_000427822.1.97938 WP_000427822.1.97981 WP_000427822.1.97983 WP_000427822.1.97986 WP_000427822.1.98036 WP_000427822.1.9805 WP_000427822.1.98080 WP_000427822.1.98086 WP_000427822.1.9811 WP_000427822.1.98201 WP_000427822.1.98236 WP_000427822.1.98250 WP_000427822.1.98263 WP_000427822.1.98402 WP_000427822.1.98418 WP_000427822.1.98438 WP_000427822.1.98440 WP_000427822.1.98448 WP_000427822.1.98457 WP_000427822.1.9850 WP_000427822.1.98502 WP_000427822.1.98513 WP_000427822.1.98551 WP_000427822.1.98570 WP_000427822.1.98607 WP_000427822.1.98627 WP_000427822.1.9863 WP_000427822.1.98634 WP_000427822.1.98731 WP_000427822.1.98762 WP_000427822.1.98763 WP_000427822.1.9877 WP_000427822.1.98779 WP_000427822.1.98801 WP_000427822.1.98818 WP_000427822.1.98899 WP_000427822.1.98931 WP_000427822.1.9899 WP_000427822.1.99040 WP_000427822.1.99057 WP_000427822.1.99083 WP_000427822.1.99097 WP_000427822.1.99107 WP_000427822.1.99163 WP_000427822.1.99198 WP_000427822.1.99215 WP_000427822.1.99278 WP_000427822.1.99335 WP_000427822.1.99350 WP_000427822.1.99360 WP_000427822.1.99363 WP_000427822.1.99369 WP_000427822.1.99370 WP_000427822.1.99388 WP_000427822.1.99397 WP_000427822.1.99426 WP_000427822.1.99456 WP_000427822.1.99463 WP_000427822.1.99469 WP_000427822.1.99483 WP_000427822.1.99490 WP_000427822.1.99493 WP_000427822.1.99546 WP_000427822.1.99577 WP_000427822.1.99579 WP_000427822.1.99595 WP_000427822.1.99671 WP_000427822.1.99676 WP_000427822.1.99764 WP_000427822.1.99824 WP_000427822.1.99829 WP_000427822.1.99837 WP_000427822.1.99841 WP_000427822.1.9992 WP_000427822.1.99924 WP_000427822.1.99961 WP_000427822.1.99996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]