SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 220664.PFL_0552 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  220664.PFL_0552
Domain Number - Region: 10-75
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.034
Family Anti-sigma factor antagonist SpoIIaa 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 220664.PFL_0552
Sequence length 288
Comment (Pseudomonas fluorescens Pf-5)
Sequence
MKKRLFIISQYLLPHHLLSRLAGCIAECRVRWFKNAFTRWFAKQYQVDMSEAQVEDVTAY
EHFNAFFTRALKDGARPLDPTPGAVLSPADGAVSQLGPIEHGRVFQAKGHSYSVLELLGG
DPALAQPFMGGDFATIYLSPKDYHRVHMPLAGTLREMVYVPGRIFSVNQTTAENVPELFA
RNERVVCIFDTERGPMALVLVGAMIVASIETVWAGLVTPPKRELKTVRYDEAARAPIHLE
KGAEMGRFKLGSTAIVLFGPDQVQWAQELAAGSPVRMGQGLGLGLPKA
Download sequence
Identical sequences Q4KJ87
WP_011058925.1.14038 WP_011058925.1.18072 WP_011058925.1.42693 PlR35 220664.PFL_0552 gi|70734056|ref|YP_257696.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]