SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 220664.PFL_0925 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  220664.PFL_0925
Domain Number 1 Region: 1-99
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.22e-16
Family Anti-sigma factor antagonist SpoIIaa 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 220664.PFL_0925
Sequence length 102
Comment (Pseudomonas fluorescens Pf-5)
Sequence
MSESAVRLGDAGELLISGVLDYRSGPGLRKQGQALIKSSQAPALVLDCSAVEKSSSVGLA
LLLAFMRDGQALGKAVSVRALPEDMREIAEVSGVTEIFAHPQ
Download sequence
Identical sequences A0A1K1XXT4 A0A2C9EGF1 A0A2K2WV46 Q4KI77
WP_011059279.1.100210 WP_011059279.1.101844 WP_011059279.1.11424 WP_011059279.1.12653 WP_011059279.1.14038 WP_011059279.1.1721 WP_011059279.1.18072 WP_011059279.1.21308 WP_011059279.1.23266 WP_011059279.1.27351 WP_011059279.1.38500 WP_011059279.1.39301 WP_011059279.1.41899 WP_011059279.1.42452 WP_011059279.1.42693 WP_011059279.1.462 WP_011059279.1.46426 WP_011059279.1.48506 WP_011059279.1.49818 WP_011059279.1.58641 WP_011059279.1.62026 WP_011059279.1.6225 WP_011059279.1.64508 WP_011059279.1.6649 WP_011059279.1.67749 WP_011059279.1.76749 WP_011059279.1.76969 WP_011059279.1.79484 WP_011059279.1.81001 WP_011059279.1.81277 WP_011059279.1.83211 WP_011059279.1.88821 220664.PFL_0925 gi|501678409|ref|YP_007998235.1| gi|70728307|ref|YP_258056.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]