SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 220664.PFL_3862 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  220664.PFL_3862
Domain Number 1 Region: 117-372
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 3.93e-66
Family D-glucarate dehydratase-like 0.0000000153
Further Details:      
 
Domain Number 2 Region: 6-130
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.77e-33
Family Enolase N-terminal domain-like 0.00000164
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 220664.PFL_3862
Sequence length 382
Comment (Pseudomonas fluorescens Pf-5)
Sequence
MHASAIESIETIIVDLPTIRPHKLAMHTMQNQTLVLIRLRCADGIEGLGESTTIGGLAYG
NESPDSIKTNIDRFVAPLLIGQDASNINAAMLRLEQSIRGNTFAKSGIESALLDAQGKRL
GLPVSELLGGRVRDALPVAWTLASGDTAKDIAEAQKMLDLRRHRIFKLKIGAGEVDRDLA
HVIAIKKALGDSASVRVDVNQAWDEAVALRACRILGGNGIDLIEQPISRNNRAGMVRLNA
SSPAPIMADESIECVEDAFNLAREGAASVFALKIAKNGGPRATLRTAAIAEAAGIGLYGG
TMLEGGIGTLASAHAFLTLNKLSWDTELFGPLLLTEDILAEPPVYRDFHLHVSKAPGLGL
SLDEERLAFFRRDKTTPVLHHT
Download sequence
Identical sequences A0A2C9EPT8 Q4K9X1
gi|70731221|ref|YP_260962.1| NYSGXRC-9450f 220664.PFL_3862 gi|501681364|ref|YP_008001190.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]