SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 220664.PFL_5322 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  220664.PFL_5322
Domain Number 1 Region: 175-309
Classification Level Classification E-value
Superfamily Riboflavin kinase-like 5.45e-43
Family ATP-dependent riboflavin kinase-like 0.00024
Further Details:      
 
Domain Number 2 Region: 15-175
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 9.29e-34
Family Adenylyltransferase 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 220664.PFL_5322
Sequence length 314
Comment (Pseudomonas fluorescens Pf-5)
Sequence
MQLVRGLHNLRPQHRGCVATIGNFDGVHRGHQAILGRLRERALELGVPSCVVIFEPQPRE
FFAPETAPARLARLRDKLQLLADAGVDRVLCLAFNQRLSKLSASEFVERILVDGLGVQHL
EVGDDFRFGCDRVGDFDFLQQAGATHGFTVEAAQTVELDGLRVSSTQVRNALAAADFDLA
ERLLGRPYRIAGRVLHGQKLARQLGTPTANVQLKRRRVPLSGVYLVSVELDGRTWPGVAN
IGVRPTVAGDGKAHLEVHLLDFAGDLYDRRLTVVFHHKLREEQRFASLEALKTAINADVA
AARAQVARIHSANR
Download sequence
Identical sequences A0A2K2WPS2 Q4K5U3
WP_011063550.1.100210 WP_011063550.1.12653 WP_011063550.1.14038 WP_011063550.1.1721 WP_011063550.1.21308 WP_011063550.1.41899 WP_011063550.1.42693 WP_011063550.1.462 WP_011063550.1.67749 gi|70732627|ref|YP_262390.1| 220664.PFL_5322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]