SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 220664.PFL_5949 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  220664.PFL_5949
Domain Number - Region: 91-147
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000196
Family NfeD domain-like 0.0081
Further Details:      
 
Domain Number - Region: 17-82
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00144
Family Glycerol-3-phosphate transporter 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 220664.PFL_5949
Sequence length 149
Comment (Pseudomonas fluorescens Pf-5)
Sequence
MLAFVQALSFWDWLALGTILLIFEVFGAGGYLLWIGLAAAIVGVLTFLIPGLSWEVQFLL
FGLLSVLTALYWWRRQRSVVRPSDQPNLNLRGQELIGKTFVVHQAIVDGRGRIKVADGVW
IAKGADAPVGARVRVVGQEGAILLVENLD
Download sequence
Identical sequences Q4K426
gi|70733234|ref|YP_263007.1| 220664.PFL_5949 GO.2815 WP_011064122.1.14038 WP_011064122.1.18072 WP_011064122.1.42693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]