SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 221109.OB1934 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  221109.OB1934
Domain Number 1 Region: 149-209
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000103
Family NfeD domain-like 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 221109.OB1934
Sequence length 215
Comment (Oceanobacillus iheyensis)
Sequence
MDLFDVQWIGFLALFLGTLFLLGEVLVNMRGIFGLLGIGFISVYFTAYLDTDSVLLIVIV
YFIGLLLIIIDGKIVNDGTLATLGLGTMIAAVALPQPNLASGLYAVIALLFGTGLSLVFL
KVFKRRKMWTKLALMDQLTKEAGYSSLSKEYEDLLETEGEALTDFRPSGTVEINKKHYSA
VTGGQWLEKGSKVKVVEVDGTKIRIEKIDKPIVEE
Download sequence
Identical sequences Q8EPZ6
gi|23099389|ref|NP_692855.1| 221109.OB1934 WP_011066331.1.3139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]