SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 221109.OB2843 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  221109.OB2843
Domain Number 1 Region: 125-370
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.17e-49
Family SCOPe 0.00000000629
Further Details:      
 
Domain Number 2 Region: 1-122
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.67e-23
Family SCOPe 0.00000387
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 221109.OB2843
Sequence length 391
Comment (Oceanobacillus iheyensis)
Sequence
MKITDLELHAVGIPRHTGFVNKHVIVKIHTDEGLTGIGEMSDFSHLPLYSVDLHDLKQGL
LSILLGQNPFDLMKINKELTDNFPETMYYYEKGSFIRNGIDNALHDLCAKYLDISVSDFL
GGRVKEKIKVCYPIFRHRFSEEVESNLDVVRQKLEQGFDVFRLYVGKNLDADEEFLSRVK
EEFGSRVRIKSYDFSHLLNWKDAHRAIKRLTKYDLGLEMIESPAPRNDFDGLYQLRLKTD
YPISEHVWSFKQQQEMIKKDAIDIFNISPVFIGGLTSAKKAAYAAEVASKDVVLGTTQEL
SVGTAAMAHLGCSLTNINHTSDPTGPELYVGDVVKNRVTYKDGYLYAPDRSVKGLGIELD
ESLLAKYQVPDLSWDNVTVHQLQDRTADTKS
Download sequence
Identical sequences Q8EMJ9
2oqy_A 2oqy_B 2oqy_C 2oqy_D 2oqy_E 2oqy_F 2oqy_G 2oqy_H 3es7_A 3es7_B 3es8_A 3es8_B 3es8_C 3es8_D 3es8_E 3es8_F 3es8_G 3es8_H 3fyy_A 3fyy_B 3gd6_A WP_011067240.1.3139 221109.OB2843 NYSGXRC-9375a gi|23100298|ref|NP_693765.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]