SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 221988.MS0256 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  221988.MS0256
Domain Number 1 Region: 144-423
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.56e-125
Family Enolase 0.000000000985
Further Details:      
 
Domain Number 2 Region: 3-138
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.01e-56
Family Enolase N-terminal domain-like 0.000000578
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 221988.MS0256
Sequence length 436
Comment (Mannheimia succiniciproducens MBEL55E)
Sequence
MAKIVKVIGREIIDSRGNPTVEAEVHLEGGFVGLAAAPSGASTGSREALELRDGDKSRFL
GKGVLKAVGAVNNEIAGAIVGKDASNQAEIDQIMIDLDGTENKSKFGANAILAVSLATAK
AAAASKGLPLYAYIAELNGTPGVYSMPLPMMNIINGGEHADNNVDIQEFMIQPVGAKTLR
EALRIGAEVFHNLAKVLKAKGLNTAVGDEGGFAPNLGSNAEALACIKEAVEKAGYVLGKD
VTLAMDCASSEFYNKENGKYEMKGEGRSFTSQEFTHYLEELCKQYPIVSIEDGQDESDWE
GFAYQTKVLGDKVQLVGDDLFVTNTKILKEGIEKGIANSILIKFNQIGSLTETLAAIKMA
KDAGYTAVISHRSGETEDATIADLAVGTAAGQIKTGSMSRSDRIAKYNQLIRIEEALERA
GTPAPFLGLKAVKGQA
Download sequence
Identical sequences Q65VZ7
gi|52424311|ref|YP_087448.1| 221988.MS0256 WP_011199438.1.101358 WP_011199438.1.33615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]