SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 221988.MS0835 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  221988.MS0835
Domain Number 1 Region: 91-148
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000101
Family NfeD domain-like 0.0061
Further Details:      
 
Weak hits

Sequence:  221988.MS0835
Domain Number - Region: 5-95
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0238
Family Glycerol-3-phosphate transporter 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 221988.MS0835
Sequence length 150
Comment (Mannheimia succiniciproducens MBEL55E)
Sequence
MDWLFAWSVWHWLILGFLLLIGEILIPGIFLLWWGISAIIMAAIMALFTTLTLTVLGISY
AVLALLLSLVWWKYQHNKDKSDEARSVLNQRNHAMIGAIGAVQEIALNGVGRGYFGDTTW
RIQGKELKVGDRIEVLKVRGITLIVRKLGN
Download sequence
Identical sequences Q65UB8
221988.MS0835 gi|52424890|ref|YP_088027.1| WP_011200014.1.101358 WP_011200014.1.33615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]