SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 222523.BCE_3809 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  222523.BCE_3809
Domain Number 1 Region: 196-458
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.32e-73
Family PFOR Pyr module 0.022
Further Details:      
 
Domain Number 2 Region: 1-221
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 1.96e-46
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.003
Further Details:      
 
Domain Number 3 Region: 468-576
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 9.82e-25
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain II 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 222523.BCE_3809
Sequence length 585
Comment (Bacillus cereus ATCC 10987)
Sequence
MISQLSWKVGGQQGEGIESTGEIFCIALNRLGYYLYGYRHFSSRIKGGHTNNKIRVSTTE
VRAISDDLDILIAFDQETIDFNFHELRPGGIVVADAKFNPTIPDNTDVNLYVIPFTDIAS
ELGTSLMKNMVAVGASSAVLGLDETAYLDVVEEIFGRKGEQVVQKNMDAIKRGSQYMKEL
LGEKVNMMQLEKADGQKRMFMIGNDAIAFGAVAGGARFMSAYPITPASEIMEYLIKKLPK
VGGTVIQTEDEIAACTMAIGANYAGVRTLTASAGPGLSLMMEAIGLAGITETPLVIVDTQ
RGGPSTGLPTKQEQSDLMAMIYGTHGEIPKIVMAPSTVEEAFYDIVEAFNLSEEYQVPVI
FLTDLQLSLGKQTVEPLKLDKVEIRRGKLDLEAELPERENKAYFKRYEVTEDGVSPRVLP
GMKNGVHHVTGVEHDETGKPSESAINRKDQMDKRFRKMENLKFNTPVYKNVKHEEADVLL
VGFNSTRGAIEEAMERLEQEGMKVNHAHVRLIHPFPTAEIDPLVKNAKRVVVVENNATGQ
LANIMKMNLGNGEKISSLLKYDGNPFLPKEIYNECKKGVVLNGNI
Download sequence
Identical sequences A0A136BG42 A0A1K0A3S2 A0A242YTN5 A0A2C3GTJ2 A0A2J9BU10 Q732V1
222523.BCE_3809 gi|42782859|ref|NP_980106.1| gi|402556103|ref|YP_006597374.1| WP_000625421.1.101550 WP_000625421.1.11060 WP_000625421.1.1850 WP_000625421.1.19173 WP_000625421.1.23110 WP_000625421.1.23200 WP_000625421.1.24759 WP_000625421.1.25757 WP_000625421.1.38517 WP_000625421.1.39001 WP_000625421.1.42165 WP_000625421.1.45089 WP_000625421.1.49802 WP_000625421.1.50770 WP_000625421.1.51656 WP_000625421.1.59052 WP_000625421.1.61944 WP_000625421.1.64706 WP_000625421.1.65758 WP_000625421.1.65983 WP_000625421.1.71648 WP_000625421.1.74337 WP_000625421.1.77370 WP_000625421.1.77902 WP_000625421.1.79043 WP_000625421.1.80239 WP_000625421.1.80571 WP_000625421.1.86082 WP_000625421.1.90671 WP_000625421.1.92347 WP_000625421.1.96356 WP_000625421.1.97617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]