SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 222929.C5P0B6 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  222929.C5P0B6
Domain Number 1 Region: 676-852
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.2e-26
Family Retroviral integrase, catalytic domain 0.011
Further Details:      
 
Domain Number 2 Region: 1115-1265,1300-1455
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.00000000000351
Family Reverse transcriptase 0.027
Further Details:      
 
Domain Number 3 Region: 376-411
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000279
Family Retrovirus zinc finger-like domains 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 222929.C5P0B6
Sequence length 1538
Comment (Coccidioides posadasii)
Sequence
MVNRTDEPEHRTPDREAPTNLPTPQTELRRSSRLRGSSPNDEQEPREESELQMLRRMMLN
QQEMMQKQQESMQRQQETVQQLAQQVNLLSGQASTANAPATMQENLEHEAQQEEEEDREI
DSDEELEEYVGNLIDTNTRIGRAITQFTKITKTVKKPMTLAGASNYLAWSKAILKVARQV
GVEKIILERQETSPRPERLKISQYWNVQNNWLHGLIDSTISAQAREHFEESDSLSAYKLW
EAVRTAFQERPEIQRESLLAELVRMTPQSAGSERNYIERFLAIRGEFERLGFKQLDHTLH
DILKMNITSRWREFIQNRFDMACQSGTNLPEKDLEGLLKDILHRIPKKDLKKGGSTKPNT
NATSSDPQKSYKNTNSESNPEKSSLQNWNCYICGKPGHLAKFCKSNKNSKPNEPKEDSKG
KGKETTTVATDKIHSVHEAAFSMKEARESTDKWILDSGAGSHATSRTDLVQMDPKSHATQ
LLMANGSKSVTRGFGTASIQTDNGELSIGGVRIVPDLQVNLISFGKLIRDGFTVEQLYVD
GEHVFLLESADKTQSFEAVLNEDDILVLRTPRIRNLLAYAFPVPTKLLEPCYVTATLENK
DRDDALLAPNHLAKTPEIKEDTMANWHKRWGHLNAHDIAILARDPRMAMRIKGVKKLGFC
ETCAKAKQARNPFEPRTRSTKPGAKIFIDIAGGGRTLSTDSDPPSYGGAKYFLLITDDAT
RYRWIYLLKERVEAPETLKNWINMIEVSTERKVGTILSDGAPELTSQQLAEFYRSKGIQQ
EITCPYTPQQDGTSERGIRLLCERTRSVLIDSGLPNELWGEALATVSMMVNLSPTSVPLY
GCKNTKPLTPFEAWTGHQPHCRWVHRWGCDAYVKILNESSKLQPRSKKVKFVGYRGMHTY
RLWDPETNSIMISRDVIFDEKLDQIPTNSLTEAEYVELPEEYDYIDPLNGWQHKLLAYLA
KEKPEIMKKLADGELEALEPTYLGEEQEILSDATEEEEANGAELPVLSTRTDIPKSIAEA
KRSEEWLYWKEALDVEVSKLQEKGTWILVEKEPQMQILSGKWVFDRKLNNTGGTVRFKAR
WVVRGFEQQEGVHYKKTYAAVVSGPTTRAFFAISTAKNWKVRVFDFVTAFLNGTLPEDER
VYVQLPTGFKHGRGNLVGLLRQGLYGLKQAARLWYQAATDYLKSLGFQISPYDAGLLYHK
RKQIYLTLHVDDCRIMGPNEAEIEWLIEKLQERFEIKEVTEQGRYLGMRVQKQPNGDLFV
NQEQYIEDLLTEYGMEDCKPSKTPMKKGISIEFAPDQTLKDGVDEQATPTNYRKGLGSLQ
FLVTCTRPDIAFAVNYLARFNSRPNRESWAAFKQILRYLKGTKSKGIVFKRDMDPEGLKP
AASSDSDWAGADPAYKSTSGYIITMNGAPISWRSQRQTSVSKSTTEAEYLAASEAACELV
WINDLLIDAGVISEGSAKLRSSKLSVDNKGAVDLAKAEAITRRARHIEIRHHMLRDWVQK
DEISIEHVGTDANKADGLTKALAMDPYAQFVSAIGVTS
Download sequence
Identical sequences C5P0B6
222929.C5P0B6 XP_003069651.1.1890 XP_003071269.1.1890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]