SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 222929.C5P0Y3 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  222929.C5P0Y3
Domain Number - Region: 334-351
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0868
Family Retrovirus zinc finger-like domains 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 222929.C5P0Y3
Sequence length 352
Comment (Coccidioides posadasii)
Sequence
MAEDTTESYATMSLGEDKRIVVHSHISMPSPGTANASWFDSRDATLFIERFYQMCKNHRT
LEDYKEGNWEVFSKEIIHEFHNQDITYKIHHQNYLQAITKKPCAWDGNIHTYVQEYTTIA
STVQANGRLDEFTKVSWFLQELPEKLWNKVIDKAKLNLSDNMSPIDFRKVVQVTMDLINQ
YKENKKIFEEDEMKQKKIEKLGEQYQLANKPPTVEAPKKTASFVKTEESKSKAKAKGSDS
INIEAAIEKITNKFTNLALAMRVQSNQIQGNSNQYYMLQREGPPKPIPNYPTNVTVNPTT
VQENTQLPVNPYLAQNGSPITGYSSAYGQEEAQTGGILTHPSCFYCGKPGHC
Download sequence
Identical sequences C5P0Y3
XP_003071486.1.1890 222929.C5P0Y3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]