SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 222929.C5P4G4 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  222929.C5P4G4
Domain Number 1 Region: 674-850
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.23e-26
Family Retroviral integrase, catalytic domain 0.011
Further Details:      
 
Domain Number 2 Region: 1113-1263,1298-1453
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.00000000000351
Family Reverse transcriptase 0.027
Further Details:      
 
Domain Number 3 Region: 376-411
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000279
Family Retrovirus zinc finger-like domains 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 222929.C5P4G4
Sequence length 1536
Comment (Coccidioides posadasii)
Sequence
MVNRTDEPEHRTPDREAPTNLPTPQTELRRSSRLRGSPPNDEQEPREESELQMLRRMMLN
QQEMMQRQQESMQRQQETVQQLAQQVNLLSGQASTANAPATMQENLEHEAQQEEEEDREI
DSDEELEEYVGNLIDTNTRIGRAITQFTKITKTVKKPMTLAGASNYLAWSKAILKVARQV
GVEKIILERQETSPRPERLKISQYWNVQNNWLHGLIDSTISAQAREHFEESDSLSAYKLW
EAVRTAFQERPEIQRESLLTELVRMTPQSAGSERNYIERFLAIRGEFERLGFKQLDHTLH
DILKMNITSRWREFIQNRFDMACQSGTNLPEKDLEGLLKDILHRIPKKDLKKGGSTKPNT
NATSSDPQKSYKNTNSESNPEKSSLQNWNCYICGKPGHLAKFCKSNKNSKPNEPKEDSKG
KGKETTTVATDKIHSVHEAAFSMKEARESTDKWILDSGAGSHATSRTDLVQMDPKSHATQ
LLMANGSKSVTRGFGTASIQTDNGELSIGGVRIVPDLQVNLISFGKLIRDGFTVEQLYVD
GEHVFLLESADKTQSFEAVLNEDDILVLRTPRIRNLLAYAFPVPTKLLEPCYVTATLENK
DDALLAPNHLAKTPEIKEDTMANWHKRWGHLNAHDIAILARDPRMAMRIKGVKKLGFCET
CAKAKQARNPFEPRTRSTKPGAKIFIDIAGGGRTLSTDSDPPSYGGAKYFLLITDDATRY
RWIYLLKERVEAPETLKNWINMIEVSTERKIGTILSDGAPELTSQQLAEFYRSKGIQQEI
TCPYTPQQDGTSERGIRLLCERTRSVLIDSGLPNELWGEALATVSMMVNLSPTSVPLYGC
KNTKPLTPFEAWTGHQPHCRWVHRWGCDAYVKILNESSKLQPRSKKVKFVGYRGMHTYRL
WDPETNSIMISRDVIFDEKLDQIPTNSLTEAEYVELPEEYDYIDPLNGWQHKLLAYLAKE
KPEIMKKLADGELEALEPTYLGEEQEILSDTTEEEETNGTELPVLSTRTDIPKSIAEAKR
SEEWLYWKEALDVEVSKLQEKGTWILVEKEPQMQILSGKWVFDRKLNNTGGTVRFKARWV
VRGFEQQEGVHYKKTYAAVVSGPTTRAFFAISTAKNWKVRVFDFVTAFLNGTLPEDERVY
VQLPTGFKHGRGNLVGLLRQGLYGLKQAARLWYQAATDYLKSLGFQISPYDAGLLYHKRK
QIYLTLHVDDCRIMGPNEAEIEWLIEKLQERFEIKEVTEQGRYLGMRVQKQPNGDLFVNQ
EQYIEDLLTEYGMEDCKPSKTPMKKGISIELAPDQTLKDGVDEQATPTNYRKGLGSLQFL
VTCTRPDIAFAVNYLARFNSRPNRESWAAFKQILRYLKGTKSKGIVFKRDMDPEGLKPAA
SSDSDWAGADPAYKSTSGYIITMNGAPISWRSQRQTSVSKSTTEAEYLAASEAACELVWI
NDLLIDAGVISEGSAKLRSSKLSVDNKGAVDLAKAEAITRRARHIEIRHHMLRDWVQKDE
ISIEHVGTDANKADGLTKALAMDPYAQFVSAIGVTS
Download sequence
Identical sequences C5P4G4
XP_003069749.1.1890 222929.C5P4G4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]