SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 222929.C5P8F8 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  222929.C5P8F8
Domain Number 1 Region: 291-346
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000146
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Domain Number 2 Region: 163-199
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000169
Family Retrovirus zinc finger-like domains 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 222929.C5P8F8
Sequence length 598
Comment (Coccidioides posadasii)
Sequence
MSSSVHFKFKSQKEPSRVSFDGTGISVFELKREIISQNRLGDGSDFDLAIYNEDTNEEYE
DDTAIIPRSTSIIARRLPASRPGKGTAARYISGKIPVTGRPSSRIEPNVTSRPGSGGGNL
RPDLNSVQSEDEKIKAVLNLQESQWREQQEDMATATPVPSNRNRGTFATAPEHPPPPGYL
CYRCRQKGHWIQACPTNNDPRFDGRYRVKRSTGIPRSFQKQVDKPEPRALDGSDEDPKLS
GVMVNADGDFVIAEPDKASWELYQEKTSAATAAAAELAAIENGKNLQSLNLLCPIDKRLF
LAPTKTPCCKKTYCNDCITNALIESDFVCPGCNTESVLLDNLSIDEDAIARIKDYEAKSV
GVLKQGDAQLTGDSKSDSKSISEDALELSNEPGPKNTKKRPAKERGANESVDSTAAPRMK
KQKSEERSNLAQGSKLESTNPSTSSFNQPCNSFDYPARTEQLQSDPLVNQGFPAFNPYPN
TGNMWNQQPAVNYLPSGQTGFYQDNMVHPMVPMGGHASPNLFSAQPNSLVYVPASNHFFP
PFPVQQPQGIPPFSNQQRTTFSEPFAKEEDNAYFRQPVNPHRHQAKQRRLRPSDYREL
Download sequence
Identical sequences C5P8F8 E9D0I0
222929.C5P8F8 XP_003068165.1.1890 CPSG_03009T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]