SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 222929.C5P9F7 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  222929.C5P9F7
Domain Number 1 Region: 179-300
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.58e-27
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000257
Further Details:      
 
Domain Number 2 Region: 294-346
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000000209
Family Retrovirus zinc finger-like domains 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 222929.C5P9F7
Sequence length 566
Comment (Coccidioides posadasii)
Sequence
MAWRNQGITGSNNVPLGRRRFGGDEADRSDTTTPASAVADAGMKRGRSPVRADPPSDGIK
KRKKRNRWGDAQENKAAGLMGLPTLIMANMTNEQLEAYTLHLRIEEISQKLRINDVVPAD
GDRSPSPAPQYDNFGRRVNTRENRYRKRLEDERHKLIEKAMKVIPNYHPPSDYRRPTKTQ
EKVYVPVNDYPEINFIGLLIGPRGNTLKKMEAESGAKIAIRGKGSVKEGKGRSDAAHTSN
QEEDLHCLIMADTEEKVNKAKKLIHNVIETAASIPEGQNELKRNQLRELAALNGTLRDDE
NQACQNCGQIGHRKYDCPEQRNFTANIICRVCGNAGHMAKDCPDRQRGTDWRNHGPSMRK
GVGDAVDREMEQLMQELSGGAPSGSGEAPRRIEAGPGGYDQGNKYGEQRDLKPWQRGPTG
GPAPWQRRDDRRDDQGHRDHGAAPPWAAGGGHGDRGDQVERGDSYGYGSHSAGYGAAPGA
AAPWQQQAPPPPPGGQAAYGYGYPGFSGAQTMGAPPGLSGVPPPPPGMGSMYSGYPGANP
PPPPPPADGPPPPPPSEQPPPPPPPA
Download sequence
Identical sequences C5P9F7
XP_003068514.1.1890 222929.C5P9F7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]