SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 222929.C5PCW7 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  222929.C5PCW7
Domain Number - Region: 368-411
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00013
Family Retrovirus zinc finger-like domains 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 222929.C5PCW7
Sequence length 660
Comment (Coccidioides posadasii)
Sequence
MPGRDQGNDSADDSRTAAVRPRSKQKPSRVTKPPPPPPLSSSSQSARGRRPPRSRRAGRQ
DPLDFVPRGATFTNASLPVENGDSSSDQLSDDGGSQHSPSDAAAQPLSDVIMQPAVNWNK
GGGGAIRTSLRGSGGTSTPVSAPASAAFDAVNDRYWRSRSASASEDERPNSSTPSANKPG
NNSGDDGRISNESAGGLVMSEDSELESDAEADNSIMLNLSTPTQNENVVQTSAINGMETF
DSHANGPTETQTQMQEVRAESVIEQPPVSRDNAVSRKHNSAEKIAAFESFSSKYPSPPRT
LADLAREDRDMQIKYIHYNKELKNVDMNLPIRCTDCMAEGHLSEICPYKECKHCGAWGIH
ESRFCPAWRRCQRCRERGHDEVDCPSLLKGLASEVPCDFCGSSQHIEGECDLLWKLPKRD
LGISQIFVSVCCSFCTSKQHLLGDCPIRPFSMNSSSWTLRTVDPASIANLGDTKLSLDGQ
NTNRDEHLTGLRIKGRANERAESDEENDDFTGSTRWKPLNKQPPRTHIRFGSGIGRGRNL
GEDRQDGNGGDRYIPHDYGREYRDREPFAGRSSRQRSLSPEPYPPRQRGGGSGRHPPPRS
PPRGRGRHPLPPLPPPPARGGSKNKRGGSRGGKGAKNSDNRDVYRPMPSAAKRAWDKHRF
Download sequence
Identical sequences C5PCW7
222929.C5PCW7 XP_003067073.1.1890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]