SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 222929.C5PE28 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  222929.C5PE28
Domain Number 1 Region: 340-369
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000872
Family Retrovirus zinc finger-like domains 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 222929.C5PE28
Sequence length 378
Comment (Coccidioides posadasii)
Sequence
MVSTQRSQPPETREPSTPAENQPEQPPTLVREETTNPDTSALSTVDETETNSATSEREST
LTSKDEIQQLREKTKLLKKMVKWQAKLNDTLQTSQKHLRSESLDIATSNPTPAKRSSVLS
PLQHTKLYQTGTYKEYRRFTSNIESIRDASGLNNEETLAYALIGLDYIESELWGVYREQN
PLKNNWNGLKEFLHMRLGDPTNRTRKSWRALFSLRKSPDETDYAYHRRFLERTLEIGEEF
EDLAKLKKNLFIWSLDKPMRTKLDEQLEIPDDIDDIVALATRLRPSVSVAYAKNAPHAKP
TNPVGSARRGMKTNDSRLPMDKRSQPQRPVREMGKDLIKDREALRKDGKCFECRQKGHLA
RDCPKKKAWLDVRNIKTT
Download sequence
Identical sequences A0A0J6Y7A0 A0A0J8S507 C5PE28 E9D1W7 J3K6M4
CIMG_13627T0 CIRT_10367 222929.C5PE28 XP_001241829.1.59393 XP_003067484.1.1890 CIHT_10325 CPSG_04175T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]