SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 222929.C5PGV4 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  222929.C5PGV4
Domain Number - Region: 576-604,640-674
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000844
Family Anti-sigma factor antagonist SpoIIaa 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 222929.C5PGV4
Sequence length 815
Comment (Coccidioides posadasii)
Sequence
MWPPIKFSPNSRMATNRAGRFLAGILGINVDYRQEPEDTFRSAAKSISSVDTFVENEPTV
AEWVSDRRPTVNDTKRYIKSLFPFSSWIFHYNLQWMLGDIIAGVTVGFVVVPQGMAYALL
ARLPAEYGLYTSFVGFLFYWIFATSKDITIGAVAVMSTIVGNVVIKVQDVNPDIPAEQIA
RGLSVICGAFLLFVGLIRCGWIVEFIPLVTITSFMTGAAISITVGQVPAMMGIRGVNTRE
AAYKVIINTLKNLPNSQLDAALGLSALFLLYGVRWFCGFMSNRQPNRRKMWFFISTLRMA
FIILLYTMISWLVNRNIPDEKEAKFRILGTVPKGFRHAGVPHMDQRLVKSFASDIPASII
VLIIEHIAISKSFGRINNYVINPSQELVAIGFTNLFGPFLGGYPATGSFSRTAIKAKAGV
RTPLAGVFTALIVLLALYALTSVFFYIPMSTLAGLIIHAVGDLITPPNVVYQFWEISPLE
AIIFFSGVLVTVFTQIENGIYATIAASAAVLLFRTAKAKGNFLGRVSVYRVTPDNFPRRG
DGHACKEDPGWSVRDAFIPMEHQDGSNPLIDAQSPYPGIFVYRFNEGFNYPNQARYLDTL
TAHIFKETRRTQLERYDKIGDRPWNDPGPRNGEQININDNRPILRAVILDFSAVNNVDVT
SIQGLIDIRNQLDRYAAPEIVEWHFSSINNRWTKRALSAAGFGYPSSGSIESLGHWKPIF
SVAALSGAEADSITTHKASESSEIDGVDEIEPYGNRGTGRKELIRIPRRIANVHGINRPF
FHMDVQAAVENAILNAEHKNATLVSTLEDKDPAKE
Download sequence
Identical sequences A0A0J6F8G6 C5PGV4
CPAT_01583 222929.C5PGV4 XP_003065902.1.1890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]