SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 222929.C5PHA7 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  222929.C5PHA7
Domain Number - Region: 1043-1076
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00227
Family Retrovirus zinc finger-like domains 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 222929.C5PHA7
Sequence length 1100
Comment (Coccidioides posadasii)
Sequence
MSQSTQASGVEPPEDDPFDTFMRQLNSPTNTRELEFMNRELDPGEKADDAVDYEDIDDDD
DLPDEEPLHGQVTVDTETQEGVDNWDNLTKSLESELHEQPAVDELDDLFGDVPSSPVAEG
VDKPVGLRMPQETPDESGVNSLVDEVDAIFSGVDRERSPTPMDMDPETLRQYQLQQALFA
MSSYGPDNPPAPPENHEELLASLWPKFDRNSMPRFLELLPPKKSHYIGKTPLKRPKRVIP
TKLKLELAQDQERSFRSTGKTARHASELESPSVVVITPPAKDEDTLSDIMDLDDDDLDEE
LPGGVTMQDLQFICADWDIKEVVSNEEEVEGAPRAPPNDEFSEDEDDWLFEVPPPAKKRK
LDKDPADYLALSHIDLPLLDDPAETTAKLARKVILDMNDPRLLIDERTPEVSVQATKFGG
ARKLSEVFGSSTKRMMQRYNISNDEAYEMLKENHKNKVRSTLGNIVLEHSMPAVRLQWPY
YKTRLARQEARSFHRPVLTFFPGLPVTFKKPTFIKRKHQKGKDAKALYDSTKSLSLADNS
TVLLVEYSEEHPMMMSNFGMGSRVINYYRKKNAEDALRPKGEVGETAVLLPEDKSPFSTF
GHVDPGETTTAIATGMFLAPLFRQEPKGTDFLVVRNSTGVEGASYYLRNIENLYVAGQQF
PSVDVPGPHSRKVTTAAKNRLKMICYRQIRKNRNHRVSVADITEHFPESTDMQNRQKMKE
FLQFSKDHKEWEMRSGEPIPDEDVLRGYVKPEDVCLLESMQVGLQYLHDAGYDREEDEDD
DGDKEGDSLEQQLAPWKATRNFLLASQGKAMLQLHGEGDPTGRGEGFSFIKTSMKGGFRA
VGESVEDKLDAQRLKELGGHSYNVARQQKSYEDSIRRIWESQKKSLSSTIEHSDAESDID
VDEAEDLFGKSSRVDRRTPLIGRRDDDTTSQFSRLSTSSQTNKVMKITRQVKNAQGQIEE
VQEIVKDPRVIKQYQKQRYEAELRELSAADMVPTGDPETDARRMKHIQDELQRLQRNKER
RHAREKQKSLMTEHKEGSPDAANSPAPATAPKGATQRKCANCGQVGHIKTNKKLCPLLNG
TMKPEEGGNATAFMMPAPAV
Download sequence
Identical sequences C5PHA7 E9CXE1
XP_003066055.1.1890 CPSG_02124T0 222929.C5PHA7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]