SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 223283.PSPTO_2179 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  223283.PSPTO_2179
Domain Number 1 Region: 95-357
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.17e-78
Family D-glucarate dehydratase-like 0.000068
Further Details:      
 
Domain Number 2 Region: 1-112
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 9.07e-31
Family Enolase N-terminal domain-like 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 223283.PSPTO_2179
Sequence length 382
Comment (Pseudomonas syringae tomato DC3000)
Sequence
MKITKLTTFIVPPRWCFLKVETDEGVVGWGEPVVEGRAHTVAAAVEELSDYLIGKDPRNI
EDIWTVLYRGGFYRGGAIHMSALAGIDQALWDIKGKALGVSVSDLLGGQVRDKIRVYSWI
GGDRPADTARAAKEAVERGFTAVKMNGTEELQFLDTFDKVDLALANVAAVRDAVGPNVGI
GVDFHGRVHKPMAKVLMKELDAYKLMFIEEPVLSENYEALKELAPLTSTPIALGERLFSR
WDFKRVLSEGYVDIIQPDASHAGGITETRKIANMAEAYDVALALHCPLGPIALAACLQLD
AVCYNAFIQEQSLGIHYNESNDLLDYVKHPEVFDYDKGMVKIPNGPGLGIEINEEYVIER
AAIGHRWRNPIWRHADGSFAEW
Download sequence
Identical sequences A0A099SV84 A0A0M0V5K6 A0A0M9HQC4 A0A0N0FZQ5 A0A0N1JND1 A0A0P9IC37 A0A0P9IP07 A0A0P9JF15 A0A0P9LMH3 A0A0P9PKN6 A0A0Q0BHA8 A0A0Q0GF02 A0A0W0PPE1 A0A1H3JTK5 A0A2K4TSQ6 F3INF8 K2RYM4 Q884B6
gi|28869382|ref|NP_792001.1| NP_792001.1.37326 WP_005617237.1.101050 WP_005617237.1.101556 WP_005617237.1.12126 WP_005617237.1.14276 WP_005617237.1.14773 WP_005617237.1.14805 WP_005617237.1.14933 WP_005617237.1.15002 WP_005617237.1.17870 WP_005617237.1.18573 WP_005617237.1.1913 WP_005617237.1.19985 WP_005617237.1.20801 WP_005617237.1.23747 WP_005617237.1.25774 WP_005617237.1.26104 WP_005617237.1.26792 WP_005617237.1.28009 WP_005617237.1.29949 WP_005617237.1.31812 WP_005617237.1.34239 WP_005617237.1.34940 WP_005617237.1.36896 WP_005617237.1.41250 WP_005617237.1.42260 WP_005617237.1.43547 WP_005617237.1.45653 WP_005617237.1.45809 WP_005617237.1.46317 WP_005617237.1.49217 WP_005617237.1.49930 WP_005617237.1.49996 WP_005617237.1.53177 WP_005617237.1.56273 WP_005617237.1.58347 WP_005617237.1.59377 WP_005617237.1.60335 WP_005617237.1.60753 WP_005617237.1.60779 WP_005617237.1.60793 WP_005617237.1.64333 WP_005617237.1.6959 WP_005617237.1.69804 WP_005617237.1.69908 WP_005617237.1.71514 WP_005617237.1.72387 WP_005617237.1.7265 WP_005617237.1.72776 WP_005617237.1.73412 WP_005617237.1.74733 WP_005617237.1.7489 WP_005617237.1.79551 WP_005617237.1.80269 WP_005617237.1.8158 WP_005617237.1.82790 WP_005617237.1.83999 WP_005617237.1.87092 WP_005617237.1.87572 WP_005617237.1.87724 WP_005617237.1.88146 WP_005617237.1.89797 WP_005617237.1.89893 WP_005617237.1.92625 WP_005617237.1.92774 WP_005617237.1.99297 223283.PSPTO_2179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]